LAPTM4B (NM_018407) Human Mass Spec Standard

SKU PH307325

LAPTM4B MS Standard C13 and N15-labeled recombinant protein (NP_060877)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC207325]
• Predicted MW: 35 kDa
• Protein Sequence:
  Protein Sequence

  >RC207325 protein sequence; Red=Cloning site Green=Tags(s); ; MTSRTRVTWPSPPRPLPVPAAAAVAFGAKGTDPAEARSSRGIEEAGPRAHGRAGREPERRRSRQQRRGGL; QARRSTLLKTCARASATAPGAMKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALAD; PDQYNFSSSELGGDFEFMDDANMCIAIAISLLMILICATATYGAYKQRAAWIIPFFCYQIFDFALNMLVA; ITVLIYPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLISCVWNCYRYINGRNSS; DVLVYVTSNDTTVLLPPYDDATVNGAAKEPPPPYVSA; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_060877
• RefSeq Size: 2242
• RefSeq ORF: 951
• Synonyms: LAPTM4beta; LC27
• Locus ID: 55353
• UniProt ID: Q86VI4
• Cytogenetics: 8q22.1
• Summary: Required for optimal lysosomal function (PubMed:21224396). Blocks EGF-stimulated EGFR intraluminal sorting and degradation. Conversely by binding with the phosphatidylinositol 4,5-bisphosphate, regulates its PIP5K1C interaction, inhibits HGS ubiquitination and relieves LAPTM4B inhibition of EGFR degradation (PubMed:25588945). Recruits SLC3A2 and SLC7A5 (the Leu transporter) to the lysosome, promoting entry of leucine and other essential amino acid (EAA) into the lysosome, stimulating activation of proton-transporting vacuolar (V)-ATPase protein pump (V-ATPase) and hence mTORC1 activation (PubMed:25998567). Plays a role as negative regulator of TGFB1 production in regulatory T cells (PubMed:26126825). Binds ceramide and facilitates its exit from late endosome in order to control cell death pathways (PubMed:26280656).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane
• Protein Pathways: Lysosome