TNF alpha (TNF) (NM_000594) Human Mass Spec Standard

SKU PH306983

TNF MS Standard C13 and N15-labeled recombinant protein (NP_000585)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC206983]
• Predicted MW: 25.6 kDa
• Protein Sequence:
  Protein Sequence

  >RC206983 protein sequence; Red=Cloning site Green=Tags(s); ; MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLI; SPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLF; KGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSA; EINRPDYLDFAESGQVYFGIIAL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_000585
• RefSeq Size: 1686
• RefSeq ORF: 699
• Synonyms: DIF; TNF-alpha; TNFA; TNFSF2; TNLG1F
• Locus ID: 7124
• UniProt ID: P01375
• Cytogenetics: 6p21.33
• Summary: This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, psoriasis, rheumatoid arthritis ankylosing spondylitis, tuberculosis, autosomal dominant polycystic kidney disease, and cancer. Mutations in this gene affect susceptibility to cerebral malaria, septic shock, and Alzheimer disease. Knockout studies in mice also suggested the neuroprotective function of this cytokine. [provided by RefSeq, Aug 2020]
• Protein Families: Druggable Genome, Secreted Protein, Transcription Factors, Transmembrane
• Protein Pathways: Adipocytokine signaling pathway, Allograft rejection, Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Asthma, Cytokine-cytokine receptor interaction, Dilated cardiomyopathy, Fc epsilon RI signaling pathway, Graft-versus-host disease, Hematopoietic cell lineage, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway, Natural killer cell mediated cytotoxicity, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, Systemic lupus erythematosus, T cell receptor signaling pathway, TGF-beta signaling pathway, Toll-like receptor signaling pathway, Type I diabetes mellitus, Type II diabetes mellitus