PAK4 (NM_001014831) Human Mass Spec Standard

SKU
PH306847
PAK4 MS Standard C13 and N15-labeled recombinant protein (NP_001014831)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206847]
Predicted MW 64.1 kDa
Protein Sequence
Protein Sequence
>RC206847 protein sequence
Red=Cloning site Green=Tags(s)

MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACITSIQPGAPKTI
VRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEEPATTARGGPGKAGSRGRFAG
HSEAGGGSGDRRRAGPEKRPKSSREGSGGPQESSRDKRPLSGPDVGTPQPAGLASGAKLAAGRPFNTYPR
ADTDHPSRGAQGEPHDVAPNGPSAGGLAIPQSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPACTPAA
PAVPGPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVK
KMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAV
CLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRL
PYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQR
ATAAELLKHPFLAKAGPPASIVPLMRQNRTR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001014831
RefSeq Size 3064
RefSeq ORF 1773
Locus ID 10298
UniProt ID O96013
Cytogenetics 19q13.2
Summary PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Axon guidance, ErbB signaling pathway, Focal adhesion, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway
Write Your Own Review
You're reviewing:PAK4 (NM_001014831) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302302 PAK4 MS Standard C13 and N15-labeled recombinant protein (NP_005875) 10 ug
$3,255.00
PH317097 PAK4 MS Standard C13 and N15-labeled recombinant protein (NP_001014832) 10 ug
$3,255.00
LC417002 PAK4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423086 PAK4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423087 PAK4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423088 PAK4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417002 Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1 100 ug
$436.00
LY423086 Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 2 100 ug
$436.00
LY423087 Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 3 100 ug
$436.00
LY423088 Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 5 100 ug
$665.00
TP302302 Recombinant protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP306847 Recombinant protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP317097 Recombinant protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP723905 Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1, 10 µg 10 ug
$820.00
TP723906 Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1, 100 µg 100 ug
$2,845.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.