EZH2 (NM_004456) Human Mass Spec Standard

SKU
PH302054
EZH2 MS Standard C13 and N15-labeled recombinant protein (NP_004447)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202054]
Predicted MW 86 kDa
Protein Sequence
Protein Sequence
>RC202054 protein sequence
Red=Cloning site Green=Tags(s)

MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHI
LTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLD
QDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDK
ESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHS
FHTLFCRRCFKYDCFLHRKCNYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKT
PPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQ
TPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDV
DTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQN
RFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWG
IFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNC
YAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004447
RefSeq Size 2723
RefSeq ORF 2253
Synonyms ENX-1; ENX1; EZH2b; KMT6; KMT6A; WVS; WVS2
Locus ID 2146
UniProt ID Q15910
Cytogenetics 7q36.1
Summary This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Feb 2011]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:EZH2 (NM_004456) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401416 EZH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC407239 EZH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430254 EZH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401416 Transient overexpression lysate of enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 1 100 ug
$436.00
LY407239 Transient overexpression lysate of enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 2 100 ug
$665.00
LY430254 Transient overexpression lysate of enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 2 100 ug
$665.00
TP302054 Recombinant protein of human enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.