OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB7 (RAB7A) (NM_004637) Human Mass Spec Standard

Be the first to review this product
SKU
PH301776
RAB7A MS Standard C13 and N15-labeled recombinant protein (NP_004628)
Size:
10 ug
  $3,360.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA380647 RAB7 Rabbit polyclonal Antibody
100 ul
$410.00
LY417854 Transient overexpression lysate of RAB7A, member RAS oncogene family (RAB7A) (as WB positive control) 100 ug
$436.00

Other products for "RAB7 or NM_004637"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201776
Predicted MW 23.5 kDa
Protein Sequence
Protein Sequence
>RC201776 protein sequence
Red=Cloning site Green=Tags(s)

MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERF
QSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQ
AWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004628
RefSeq Size 2240
RefSeq ORF 621
Synonyms CMT2B; PRO2706; RAB7
Locus ID 7879
UniProt ID P51149
Cytogenetics 3q21.3
Summary RAB family members are small, RAS-related GTP-binding proteins that are important regulators of vesicular transport. Each RAB protein targets multiple proteins that act in exocytic / endocytic pathways. This gene encodes a RAB family member that regulates vesicle traffic in the late endosomes and also from late endosomes to lysosomes. This encoded protein is also involved in the cellular vacuolation of the VacA cytotoxin of Helicobacter pylori. Mutations at highly conserved amino acid residues in this gene have caused some forms of Charcot-Marie-Tooth (CMT) type 2 neuropathies. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB7" proteins (3)
SKU Description Size Price
LC417854 Lyophilized RAB7A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417854 Transient overexpression lysate of RAB7A, member RAS oncogene family (RAB7A) (as WB positive control) 100 ug
$436.00
TP301776 Recombinant protein of human RAB7A, member RAS oncogene family (RAB7A), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products