GATA3 (NM_002051) Human Mass Spec Standard

SKU
PH301618
GATA3 MS Standard C13 and N15-labeled recombinant protein (NP_002042)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201618]
Predicted MW 48 kDa
Protein Sequence
Protein Sequence
>RC201618 protein sequence
Red=Cloning site Green=Tags(s)

MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRA
TVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSS
LSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGG
ASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGT
GHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHN
INRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSSLSFGPHHPSSMVTAMG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002042
RefSeq Size 3067
RefSeq ORF 1332
Synonyms HDR; HDRS
Locus ID 2625
UniProt ID P23771
Cytogenetics 10p14
Summary This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia. [provided by RefSeq, Nov 2009]
Protein Families Adult stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors
Write Your Own Review
You're reviewing:GATA3 (NM_002051) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400759 GATA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424146 GATA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400759 Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 2 100 ug
$436.00
LY424146 Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 1 100 ug
$665.00
TP301618 Recombinant protein of human GATA binding protein 3 (GATA3), transcript variant 2, 20 µg 20 ug
$867.00
TP761574 Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00
TP762348 Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, Pro189-Ser201(8 reapeat regions linked with GGGGS), with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00
TP762449 Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, Met1-Thr156, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.