OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GATA3 (NM_002051) Human Mass Spec Standard

Be the first to review this product
SKU
PH301618
GATA3 MS Standard C13 and N15-labeled recombinant protein (NP_002042)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809095 GATA3 mouse monoclonal antibody, clone OTI8H4 (formerly 8H4) 100 ul
$447.00
LY424146 Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "GATA3 or NM_002051"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201618
Predicted MW 48 kDa
Protein Sequence
Protein Sequence
>RC201618 protein sequence
Red=Cloning site Green=Tags(s)

MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRA
TVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSS
LSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGG
ASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGT
GHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHN
INRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSSLSFGPHHPSSMVTAMG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002042
RefSeq Size 3067
RefSeq ORF 1332
Synonyms HDR; HDRS
Locus ID 2625
UniProt ID P23771
Cytogenetics 10p14
Summary This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia. provided by RefSeq, Nov 2009
Protein Families Adult stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GATA3" proteins (8)
SKU Description Size Price
LC400759 Lyophilized GATA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424146 Lyophilized GATA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400759 Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424146 Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP301618 Recombinant protein of human GATA binding protein 3 (GATA3), transcript variant 2, 20 µg 20 ug
$867.00
TP761574 Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00
TP762348 Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, Pro189-Ser201(8 reapeat regions linked with GGGGS), with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00
TP762449 Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, Met1-Thr156, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$240.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products