SNAP23 (NM_003825) Human Mass Spec Standard

SKU
PH301596
SNAP23 MS Standard C13 and N15-labeled recombinant protein (NP_003816)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201596]
Predicted MW 23.4 kDa
Protein Sequence
Protein Sequence
>RC201596 protein sequence
Red=Cloning site Green=Tags(s)

MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETE
KTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQPTTGAASGGYI
KRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLID
S

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003816
RefSeq Size 2650
RefSeq ORF 633
Synonyms HsT17016; SNAP-23; SNAP23A; SNAP23B
Locus ID 8773
UniProt ID O00161
Cytogenetics 15q15.1-q15.2
Summary Specificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin. These proteins, together with SNAP25 (synaptosome-associated protein of 25 kDa), form a complex which serves as a binding site for the general membrane fusion machinery. Synaptobrevin/VAMP and syntaxin are believed to be involved in vesicular transport in most, if not all cells, while SNAP25 is present almost exclusively in the brain, suggesting that a ubiquitously expressed homolog of SNAP25 exists to facilitate transport vesicle/target membrane fusion in other tissues. The protein encoded by this gene is structurally and functionally similar to SNAP25 and binds tightly to multiple syntaxins and synaptobrevins/VAMPs. It is an essential component of the high affinity receptor for the general membrane fusion machinery and is an important regulator of transport vesicle docking and fusion. Two alternative transcript variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways SNARE interactions in vesicular transport
Write Your Own Review
You're reviewing:SNAP23 (NM_003825) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401266 SNAP23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408951 SNAP23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401266 Transient overexpression lysate of synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1 100 ug
$436.00
LY408951 Transient overexpression lysate of synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 2 100 ug
$436.00
TP301596 Recombinant protein of human synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1, 20 µg 20 ug
$737.00
TP761961 Purified recombinant protein of Human synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 2,full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.