SNAP23 (NM_003825) Human Tagged ORF Clone
SKU
RC201596
SNAP23 (Myc-DDK-tagged)-Human synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | SNAP23 |
Synonyms | HsT17016; SNAP-23; SNAP23A; SNAP23B |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC201596 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGATAATCTGTCATCAGAAGAAATTCAACAGAGAGCTCACCAGATTACTGATGAGTCTCTGGAAAGTA CGAGGAGAATCCTGGGTTTAGCCATTGAGTCTCAGGATGCAGGAATCAAGACCATCACTATGCTGGATGA ACAAAAGGAACAACTAAACCGCATAGAAGAAGGCTTGGACCAAATAAATAAGGACATGAGAGAGACAGAG AAGACTTTAACAGAACTCAACAAATGCTGTGGCCTTTGTGTCTGCCCATGTAATAGAACAAAGAACTTTG AGTCTGGCAAGGCTTATAAGACAACATGGGGAGATGGTGGAGAAAACTCACCTTGCAATGTAGTATCTAA ACAGCCAGGCCCGGTGACAAATGGTCAGCTTCAGCAACCAACAACGGGAGCAGCCAGTGGTGGATACATT AAACGCATAACTAATGATGCCAGAGAAGATGAAATGGAAGAGAACCTGACTCAAGTGGGCAGTATCCTGG GAAATCTAAAAGACATGGCCCTGAACATAGGCAATGAGATTGATGCTCAAAATCCACAAATAAAACGAAT CACAGACAAGGCTGACACCAACAGAGATCGTATTGATATTGCCAATGCCAGAGCAAAGAAACTCATTGAC AGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201596 protein sequence
Red=Cloning site Green=Tags(s) MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETE KTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQPTTGAASGGYI KRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLID S myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_003825 |
ORF Size | 633 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_003825.4 |
RefSeq Size | 2650 bp |
RefSeq ORF | 636 bp |
Locus ID | 8773 |
UniProt ID | O00161 |
Cytogenetics | 15q15.1-q15.2 |
Domains | SNAP-25, t_SNARE |
Protein Families | Druggable Genome |
Protein Pathways | SNARE interactions in vesicular transport |
MW | 23.4 kDa |
Summary | Specificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin. These proteins, together with SNAP25 (synaptosome-associated protein of 25 kDa), form a complex which serves as a binding site for the general membrane fusion machinery. Synaptobrevin/VAMP and syntaxin are believed to be involved in vesicular transport in most, if not all cells, while SNAP25 is present almost exclusively in the brain, suggesting that a ubiquitously expressed homolog of SNAP25 exists to facilitate transport vesicle/target membrane fusion in other tissues. The protein encoded by this gene is structurally and functionally similar to SNAP25 and binds tightly to multiple syntaxins and synaptobrevins/VAMPs. It is an essential component of the high affinity receptor for the general membrane fusion machinery and is an important regulator of transport vesicle docking and fusion. Two alternative transcript variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC201596L1 | Lenti ORF clone of Human synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC201596L2 | Lenti ORF clone of Human synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1, mGFP tagged | 10 ug |
$600.00
|
|
RC201596L3 | Lenti ORF clone of Human synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1, Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC201596L4 | Lenti ORF clone of Human synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1, mGFP tagged | 10 ug |
$600.00
|
|
RG201596 | SNAP23 (tGFP-tagged) - Human synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1 | 10 ug |
$489.00
MSRP
$500.00
MSRP
$500.00
|
|
SC111720 | SNAP23 (untagged)-Human synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1 | 10 ug |
$300.00
|
|
SC322216 | SNAP23 (untagged)-Human synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1 | 10 ug |
$300.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.