E5b (NC_001355) Virus Tagged ORF Clone

SKU
VC101998
Myc-DDK-tagged ORF clone of viral ORF for E5b protein [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040302
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol E5b
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101998 represents NCBI reference of NP_040302 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGCTCACCTGCCAGTTTAACGACGGCGACACTTGGCTGGGTCTGTGGCTTCTGTGCGCTTTTATTG
TAGGCATGCTGGGATTGCTGCTGATGCATTATAGAGCCGTGCAGGGGGACAAGCACACGAAGTGTAAAAA
GTGCAACAAACACAACTGTAACGACGATTATGTGACAATGCATTACACTACAGATGGGGACTATATCTAT
ATGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC101998 representing NP_040302
Red=Cloning sites Green=Tags

MMLTCQFNDGDTWLGLWLLCAFIVGMLGLLLMHYRAVQGDKHTKCKKCNKHNCNDDYVTMHYTTDGDYIY
MN

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_001355
ORF Size 216 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001355.1, NP_040302
RefSeq ORF 216 bp
Locus ID 1489367
MW 8.4 kDa
Write Your Own Review
You're reviewing:E5b (NC_001355) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC101992 Myc-DDK-tagged ORF clone of viral ORF for E6 protein [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040296 10 ug
$289.00
VC101993 Myc-DDK-tagged ORF clone of viral ORF for E7 protein [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040297 10 ug
$289.00
VC101994 Myc-DDK-tagged ORF clone of viral ORF for replication protein E1 [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040298 10 ug
$664.00
VC101995 Myc-DDK-tagged ORF clone of viral ORF for regulatory protein E2 [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040299 10 ug
$503.00
VC101996 Myc-DDK-tagged ORF clone of viral ORF for E4 protein [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040300 10 ug
$165.00
VC101997 Myc-DDK-tagged ORF clone of viral ORF for E5a protein [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040301 10 ug
$165.00
VC101999 Myc-DDK-tagged ORF clone of viral ORF for minor capsid protein L2 [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040303 10 ug
$503.00
VC102000 Myc-DDK-tagged ORF clone of viral ORF for major capsid protein L1 [Human papillomavirus type 6b], codon optimized for human cell expression, NP_040304 10 ug
$503.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.