BRLF1 (NC_007605) Virus Tagged ORF Clone
CAT#: VC101134
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for BRLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401674
View other clones from "Virus" (71)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | BRLF1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101134 represents NCBI reference of YP_401674 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGACCAAAAAAAGACGGTTTGGAGGATTTCCTTCGACTCACTCCTGAGATCAAGAAACAGCTGGGAT CCCTCGTTTCTGACTACTGTAATGTTCTGAATAAGGAGTTTACAGCCGGATCTGTGGAGATCACACTGCG CTCCTACAAGATCTGCAAGGCCTTCATTAATGAGGCGAAAGCTCACGGTAGGGAGTGGGGTGGTCTCATG GCTACTCTCAACATTTGCAACTTTTGGGCCATACTTAGAAATAATCGGGTCAGGAGAAGGGCCGAGAACG CCGGTAACGACGCTTGCTCAATAGCCTGTCCCATTGTGATGCGCTACGTGCTTGATCATCTCATTGTGGT CACCGACAGATTTTTCATCCAGGCGCCAAGTAATAGGGTCATGATCCCCGCGACTATCGGTACCGCCATG TACAAACTCCTCAAACACTCTCGAGTTCGGGCCTATACCTACAGCAAGGTGTTGGGTGTGGACAGGGCCG CCATTATGGCGAGCGGAAAGCAAGTTGTTGAGCACCTGAACCGGATGGAAAAGGAAGGCCTCTTGAGCTC TAAGTTCAAGGCATTCTGCAAGTGGGTGTTTACCTACCCTGTGCTGGAGGAGATGTTCCAGACCATGGTG TCTAGTAAGACTGGACACCTTACAGATGATGTGAAAGACGTTCGAGCGCTCATCAAGACACTTCCACGAG CCTCCTATTCCTCACACGCAGGCCAGCGCAGCTACGTCAGTGGAGTCCTCCCGGCATGTCTGCTTTCAAC AAAATCTAAGGCTGTGGAGACACCTATCCTGGTTTCTGGCGCAGACCGCATGGACGAGGAACTTATGGGA AATGATGGGGGCGCATCTCACACAGAGGCCCGGTACTCAGAAAGCGGACAATTTCATGCTTTTACCGACG AACTGGAGAGTCTGCCATCCCCTACAATGCCCTTGAAACCCGGGGCTCAGAGCGCCGATTGTGGCGATTC AAGCAGCTCCTCATCCGACAGTGGCAATAGTGATACAGAGCAAAGTGAGCGGGAGGAGGCCAGAGCCGAG GCCCCTCGATTGAGAGCACCAAAATCTCGGCGCACGAGTAGGCCTAATCGGGGCCAAACCCCCTGTCCGT CAAACGCCGCAGAGCCAGAGCAGCCCTGGATCGCCGCTGTGCACCAGGAAAGTGACGAGCGCCCAATTTT CCCTCATCCGAGCAAGCCTACATTCCTGCCTCCCGTTAAACGCAAGAAGGGATTGAGAGATTCTAGGGAG GGCATGTTTCTGCCAAAACCAGAGGCAGGCAGTGCAATCTCCGACGTGTTTGAGGGGCGGGAAGTTTGTC AGCCTAAGCGGATACGACCATTCCATCCCCCTGGAAGCCCTTGGGCCAATAGACCCCTGCCCGCCTCTTT GGCCCCCACACCCACCGGCCCTGTCCATGAGCCTGTCGGAAGTTTGACACCGGCTCCCGTACCACAGCCT CTTGATCCCGCCCCTGCAGTGACCCCCGAGGCAAGCCATCTCCTGGAAGATCCGGACGAGGAAACTTCAC AAGCGGTCAAGGCTCTGCGGGAGATGGCAGATACCGTGATCCCCCAAAAAGAGGAAGCCGCAATTTGTGG ACAAATGGATCTGAGCCATCCCCCGCCCAGAGGGCACCTTGACGAGCTGACCACGACACTGGAAAGCATG ACTGAAGACCTGAATCTCGACTCCCCCTTGACCCCTGAGCTCAACGAGATACTCGATACATTCCTTAATG ATGAGTGCCTCTTGCATGCTATGCACATAAGCACCGGCTTGTCTATCTTTGACACAAGTCTGTTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101134 representing YP_401674
Red=Cloning sites Green=Tags MRPKKDGLEDFLRLTPEIKKQLGSLVSDYCNVLNKEFTAGSVEITLRSYKICKAFINEAKAHGREWGGLM ATLNICNFWAILRNNRVRRRAENAGNDACSIACPIVMRYVLDHLIVVTDRFFIQAPSNRVMIPATIGTAM YKLLKHSRVRAYTYSKVLGVDRAAIMASGKQVVEHLNRMEKEGLLSSKFKAFCKWVFTYPVLEEMFQTMV SSKTGHLTDDVKDVRALIKTLPRASYSSHAGQRSYVSGVLPACLLSTKSKAVETPILVSGADRMDEELMG NDGGASHTEARYSESGQFHAFTDELESLPSPTMPLKPGAQSADCGDSSSSSSDSGNSDTEQSEREEARAE APRLRAPKSRRTSRPNRGQTPCPSNAAEPEQPWIAAVHQESDERPIFPHPSKPTFLPPVKRKKGLRDSRE GMFLPKPEAGSAISDVFEGREVCQPKRIRPFHPPGSPWANRPLPASLAPTPTGPVHEPVGSLTPAPVPQP LDPAPAVTPEASHLLEDPDEETSQAVKALREMADTVIPQKEEAAICGQMDLSHPPPRGHLDELTTTLESM TEDLNLDSPLTPELNEILDTFLNDECLLHAMHISTGLSIFDTSLF TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_007605 |
ORF Size | 1815 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NC_007605.1, YP_401674 |
RefSeq ORF | 1815 bp |
Locus ID | 3783727 |
UniProt ID | P03211 |
MW | 66.6 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101093 | Myc-DDK-tagged ORF clone of viral ORF for K15 [Human herpesvirus 4], codon optimized for human cell expression, YP_401631 |
USD 686.00 |
|
VC101094 | Myc-DDK-tagged ORF clone of viral ORF for LMP-2B [Human herpesvirus 4], codon optimized for human cell expression, YP_401632 |
USD 686.00 |
|
VC101095 | Myc-DDK-tagged ORF clone of viral ORF for BNRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401633 |
USD 1,262.00 |
|
VC101096 | Myc-DDK-tagged ORF clone of viral ORF for BCRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401634 |
USD 330.00 |
|
VC101108 | Myc-DDK-tagged ORF clone of viral ORF for BHRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401646 |
USD 300.00 |
|
VC101109 | Myc-DDK-tagged ORF clone of viral ORF for BFLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401647 |
USD 330.00 |
|
VC101110 | Myc-DDK-tagged ORF clone of viral ORF for BFLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401648 |
USD 538.00 |
|
VC101111 | Myc-DDK-tagged ORF clone of viral ORF for BFRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401649 |
USD 503.00 |
|
VC101112 | Myc-DDK-tagged ORF clone of viral ORF for BFRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401650 |
USD 825.00 |
|
VC101116 | Myc-DDK-tagged ORF clone of viral ORF for BORF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401654 |
USD 503.00 |
|
VC101117 | Myc-DDK-tagged ORF clone of viral ORF for BORF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401655 |
USD 832.00 |
|
VC101118 | Myc-DDK-tagged ORF clone of viral ORF for BaRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401656 |
USD 330.00 |
|
VC101119 | Myc-DDK-tagged ORF clone of viral ORF for BMRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401657 |
USD 686.00 |
|
VC101120 | Myc-DDK-tagged ORF clone of viral ORF for BMRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401658 |
USD 503.00 |
|
VC101121 | Myc-DDK-tagged ORF clone of viral ORF for BSLF2/BMLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401659 |
USD 503.00 |
|
VC101122 | Myc-DDK-tagged ORF clone of viral ORF for BSLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401662 |
USD 880.00 |
|
VC101123 | Myc-DDK-tagged ORF clone of viral ORF for BSRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401663 |
USD 330.00 |
|
VC101124 | Myc-DDK-tagged ORF clone of viral ORF for BLLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401664 |
USD 330.00 |
|
VC101125 | Myc-DDK-tagged ORF clone of viral ORF for BLRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401665 |
USD 165.00 |
|
VC101126 | Myc-DDK-tagged ORF clone of viral ORF for BLRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401666 |
USD 165.00 |
|
VC101128 | Myc-DDK-tagged ORF clone of viral ORF for BLLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401668 |
USD 165.00 |
|
VC101132 | Myc-DDK-tagged ORF clone of viral ORF for BZLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401672 |
USD 330.00 |
|
VC101133 | Myc-DDK-tagged ORF clone of viral ORF for BZLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401673 |
USD 450.00 |
|
VC101135 | Myc-DDK-tagged ORF clone of viral ORF for BRRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401675 |
USD 330.00 |
|
VC101136 | Myc-DDK-tagged ORF clone of viral ORF for BRRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401676 |
USD 550.00 |
|
VC101138 | Myc-DDK-tagged ORF clone of viral ORF for BKRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401678 |
USD 165.00 |
|
VC101139 | Myc-DDK-tagged ORF clone of viral ORF for BKRF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401679. Note: ORF is codon optimized |
USD 330.00 |
|
VC101140 | Myc-DDK-tagged ORF clone of viral ORF for BKRF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401680 |
USD 330.00 |
|
VC101141 | Myc-DDK-tagged ORF clone of viral ORF for BBLF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401681 |
USD 815.00 |
|
VC101142 | Myc-DDK-tagged ORF clone of viral ORF for BBRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401682 |
USD 628.00 |
|
VC101143 | Myc-DDK-tagged ORF clone of viral ORF for BBRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401683 |
USD 330.00 |
|
VC101144 | Myc-DDK-tagged ORF clone of viral ORF for BBLF2/BBLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401684 |
USD 714.00 |
|
VC101145 | Myc-DDK-tagged ORF clone of viral ORF for BBRF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401685 |
USD 503.00 |
|
VC101146 | Myc-DDK-tagged ORF clone of viral ORF for BBLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401686 |
USD 165.00 |
|
VC101147 | Myc-DDK-tagged ORF clone of viral ORF for BGLF5 [Human herpesvirus 4], codon optimized for human cell expression, YP_401687 |
USD 503.00 |
|
VC101148 | Myc-DDK-tagged ORF clone of viral ORF for BGLF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401688 |
USD 503.00 |
|
VC101149 | Myc-DDK-tagged ORF clone of viral ORF for BGLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401689 |
USD 330.00 |
|
VC101150 | Myc-DDK-tagged ORF clone of viral ORF for BGRF1/BDRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401690 |
USD 695.00 |
|
VC101151 | Myc-DDK-tagged ORF clone of viral ORF for BGLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401691 |
USD 503.00 |
|
VC101152 | Myc-DDK-tagged ORF clone of viral ORF for BGLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401692 |
USD 519.00 |
|
VC101153 | Myc-DDK-tagged ORF clone of viral ORF for BDLF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401693 |
USD 330.00 |
|
VC101154 | Myc-DDK-tagged ORF clone of viral ORF for BDLF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401694 |
USD 330.00 |
|
VC101155 | Myc-DDK-tagged ORF clone of viral ORF for BDLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401695 |
USD 503.00 |
|
VC101156 | Myc-DDK-tagged ORF clone of viral ORF for BDLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401696 |
USD 330.00 |
|
VC101157 | Myc-DDK-tagged ORF clone of viral ORF for BcLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401697 |
USD 1,299.00 |
|
VC101158 | Myc-DDK-tagged ORF clone of viral ORF for BcRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401698 |
USD 1,030.00 |
|
VC101159 | Myc-DDK-tagged ORF clone of viral ORF for BTRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401699 |
USD 503.00 |
|
VC101160 | Myc-DDK-tagged ORF clone of viral ORF for BXLF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401700 |
USD 711.00 |
|
VC101161 | Myc-DDK-tagged ORF clone of viral ORF for BXLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401701 |
USD 621.00 |
|
VC101162 | Myc-DDK-tagged ORF clone of viral ORF for BXRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401702 |
USD 330.00 |
|
VC101163 | Myc-DDK-tagged ORF clone of viral ORF for BVRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401703 |
USD 584.00 |
|
VC101164 | Myc-DDK-tagged ORF clone of viral ORF for BVRF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401704 |
USD 619.00 |
|
VC101165 | Myc-DDK-tagged ORF clone of viral ORF for BdRF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401705 |
USD 686.00 |
|
VC101166 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein [Human herpesvirus 4], codon optimized for human cell expression, YP_401706 |
USD 330.00 |
|
VC101168 | Myc-DDK-tagged ORF clone of viral ORF for LF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401708 |
USD 503.00 |
|
VC101169 | Myc-DDK-tagged ORF clone of viral ORF for LF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401709 |
USD 503.00 |
|
VC101170 | Myc-DDK-tagged ORF clone of viral ORF for RPMS1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401710 |
USD 165.00 |
|
VC101171 | Myc-DDK-tagged ORF clone of viral ORF for BILF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401711 |
USD 450.00 |
|
VC101172 | Myc-DDK-tagged ORF clone of viral ORF for BALF5 [Human herpesvirus 4], codon optimized for human cell expression, YP_401712 |
USD 972.00 |
|
VC101173 | Myc-DDK-tagged ORF clone of viral ORF for BALF4 [Human herpesvirus 4], codon optimized for human cell expression, YP_401713 |
USD 863.00 |
|
VC101174 | Myc-DDK-tagged ORF clone of viral ORF for A73 [Human herpesvirus 4], codon optimized for human cell expression, YP_401714 |
USD 165.00 |
|
VC101175 | Myc-DDK-tagged ORF clone of viral ORF for BALF3 [Human herpesvirus 4], codon optimized for human cell expression, YP_401715 |
USD 690.00 |
|
VC101177 | Myc-DDK-tagged ORF clone of viral ORF for BALF2 [Human herpesvirus 4], codon optimized for human cell expression, YP_401717 |
USD 1,080.00 |
|
VC101178 | Myc-DDK-tagged ORF clone of viral ORF for BALF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401718 |
USD 330.00 |
|
VC101179 | Myc-DDK-tagged ORF clone of viral ORF for BARF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401719 |
USD 330.00 |
|
VC101180 | Myc-DDK-tagged ORF clone of viral ORF for BNLF2b [Human herpesvirus 4], codon optimized for human cell expression, YP_401720 |
USD 165.00 |
|
VC101181 | Myc-DDK-tagged ORF clone of viral ORF for BNLF2a [Human herpesvirus 4], codon optimized for human cell expression, YP_401721 |
USD 165.00 |
|
VC101183 | Myc-DDK-tagged ORF clone of viral ORF for BFRF1A [Human herpesvirus 4], codon optimized for human cell expression, YP_401728 |
USD 165.00 |
|
VC101184 | Myc-DDK-tagged ORF clone of viral ORF for BGLF35 [Human herpesvirus 4], codon optimized for human cell expression, YP_401724 |
USD 225.00 |
|
VC101185 | Myc-DDK-tagged ORF clone of viral ORF for BDLF35 [Human herpesvirus 4], codon optimized for human cell expression, YP_401725 |
USD 240.00 |
|
VC101186 | Myc-DDK-tagged ORF clone of viral ORF for BVLF1 [Human herpesvirus 4], codon optimized for human cell expression, YP_401726 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review