E3 CR1-beta0 (AC_000017) Virus Tagged ORF Clone
SKU
VC100025
Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-beta0 [Human adenovirus 1], codon optimized for human cell expression, AP_000522
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Virus Tagged ORF Clone |
---|---|
Target Symbol | E3 CR1-beta0 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>The Viral ORF clone VC100025 represents NCBI reference of AP_000522 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGCCAGGTCGGAAAAGCCAGGCACACCCCTACTACTCTGAAATCCGGTTTCCCAGGGCTCCGCGCAC CCGATTTTAATTCTACCTGCCCTGTCGAGTTCATTCAGCAGTTGCAGCAGCCTGCCTTTGACATGGTGGA TACAGTGAACAGTTATAATACGGCTACTGGGTTGACCAGCACCCAGGACATGCCACAAGTGAGTACATTT GTCAATAATTGGGCGAACCTGGGCATGTGGTGGTTCAGCATCGCACTGATGTTCGTCTGTCTGATCATAA TGTGGCTTTCATGTTGCTTGAAACGGAAGCGCGCACGGCCGCCCATCTACAAACCAATTATCGTGCTTAA CCCAAATAATGACGGCATCCATCGCCTGGATGGTTTGAATACCTGTAGCTTTTCATTTGCAGTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC100025 representing AP_000522
Red=Cloning sites Green=Tags MCQVGKARHTPTTLKSGFPGLRAPDFNSTCPVEFIQQLQQPAFDMVDTVNSYNTATGLTSTQDMPQVSTF VNNWANLGMWWFSIALMFVCLIIMWLSCCLKRKRARPPIYKPIIVLNPNNDGIHRLDGLNTCSFSFAV TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | AC_000017 |
ORF Size | 414 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | AC_000017.1, AP_000522 |
RefSeq ORF | 414 bp |
MW | 15.5 kDa |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
VC100001 | Myc-DDK-tagged ORF clone of viral ORF for E1A [Human adenovirus 1], codon optimized for human cell expression, AP_000498 | 10 ug |
$289.00
MSRP
$300.00
MSRP
$300.00
|
|
VC100002 | Myc-DDK-tagged ORF clone of viral ORF for E1B 19K [Human adenovirus 1], codon optimized for human cell expression, AP_000499 | 10 ug |
$330.00
|
|
VC100003 | Myc-DDK-tagged ORF clone of viral ORF for E1B 55K [Human adenovirus 1], codon optimized for human cell expression, AP_000500 | 10 ug |
$503.00
|
|
VC100004 | Myc-DDK-tagged ORF clone of viral ORF for IX [Human adenovirus 1], codon optimized for human cell expression, AP_000501 | 10 ug |
$165.00
|
|
VC100005 | Myc-DDK-tagged ORF clone of viral ORF for IVa2 [Human adenovirus 1], codon optimized for human cell expression, AP_000502 | 10 ug |
$503.00
|
|
VC100007 | Myc-DDK-tagged ORF clone of viral ORF for pTP [Human adenovirus 1], codon optimized for human cell expression, AP_000504 | 10 ug |
$675.00
|
|
VC100008 | Myc-DDK-tagged ORF clone of viral ORF for 52K [Human adenovirus 1], codon optimized for human cell expression, AP_000505 | 10 ug |
$503.00
|
|
VC100009 | Myc-DDK-tagged ORF clone of viral ORF for pIIIa [Human adenovirus 1], codon optimized for human cell expression, AP_000506 | 10 ug |
$599.00
|
|
VC100010 | Myc-DDK-tagged ORF clone of viral ORF for III [Human adenovirus 1], codon optimized for human cell expression, AP_000507 | 10 ug |
$588.00
|
|
VC100011 | Myc-DDK-tagged ORF clone of viral ORF for pVII [Human adenovirus 1], codon optimized for human cell expression, AP_000508 | 10 ug |
$330.00
|
|
VC100012 | Myc-DDK-tagged ORF clone of viral ORF for V [Human adenovirus 1], codon optimized for human cell expression, AP_000509 | 10 ug |
$503.00
|
|
VC100013 | Myc-DDK-tagged ORF clone of viral ORF for pX [Human adenovirus 1], codon optimized for human cell expression, AP_000510 | 10 ug |
$165.00
|
|
VC100014 | Myc-DDK-tagged ORF clone of viral ORF for pVI [Human adenovirus 1], codon optimized for human cell expression, AP_000511 | 10 ug |
$330.00
|
|
VC100015 | Myc-DDK-tagged ORF clone of viral ORF for hexon [Human adenovirus 1], codon optimized for human cell expression, AP_000512 | 10 ug |
$971.00
|
|
VC100016 | Myc-DDK-tagged ORF clone of viral ORF for protease [Human adenovirus 1], codon optimized for human cell expression, AP_000513 | 10 ug |
$330.00
|
|
VC100017 | Myc-DDK-tagged ORF clone of viral ORF for DBP [Human adenovirus 1], codon optimized for human cell expression, AP_000514 | 10 ug |
$542.00
|
|
VC100018 | Myc-DDK-tagged ORF clone of viral ORF for 100K [Human adenovirus 1], codon optimized for human cell expression, AP_000515 | 10 ug |
$813.00
|
|
VC100019 | Myc-DDK-tagged ORF clone of viral ORF for 33K [Human adenovirus 1], codon optimized for human cell expression, AP_000516 | 10 ug |
$330.00
|
|
VC100020 | Myc-DDK-tagged ORF clone of viral ORF for 22K [Human adenovirus 1], codon optimized for human cell expression, AP_000517 | 10 ug |
$330.00
|
|
VC100021 | Myc-DDK-tagged ORF clone of viral ORF for pVIII [Human adenovirus 1], codon optimized for human cell expression, AP_000518 | 10 ug |
$330.00
|
|
VC100022 | Myc-DDK-tagged ORF clone of viral ORF for E3 125K [Human adenovirus 1], codon optimized for human cell expression, AP_000519 | 10 ug |
$165.00
|
|
VC100023 | Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-alpha0 [Human adenovirus 1], codon optimized for human cell expression, AP_000520 | 10 ug |
$165.00
|
|
VC100024 | Myc-DDK-tagged ORF clone of viral ORF for E3 gp19K [Human adenovirus 1], codon optimized for human cell expression, AP_000521 | 10 ug |
$165.00
|
|
VC100026 | Myc-DDK-tagged ORF clone of viral ORF for E3 RID-alpha [Human adenovirus 1], codon optimized for human cell expression, AP_000523 | 10 ug |
$165.00
|
|
VC100027 | Myc-DDK-tagged ORF clone of viral ORF for E3 147K [Human adenovirus 1], codon optimized for human cell expression, AP_000525 | 10 ug |
$165.00
|
|
VC100028 | Myc-DDK-tagged ORF clone of viral ORF for E3 RID-beta [Human adenovirus 1], codon optimized for human cell expression, AP_000524 | 10 ug |
$165.00
|
|
VC100029 | Myc-DDK-tagged ORF clone of viral ORF for U exon, partial [Human adenovirus 1], codon optimized for human cell expression, AP_000526 | 10 ug |
$165.00
|
|
VC100030 | Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus 1], codon optimized for human cell expression, AP_000527 | 10 ug |
$596.00
|
|
VC100031 | Myc-DDK-tagged ORF clone of viral ORF for E4 34K [Human adenovirus 1], codon optimized for human cell expression, AP_000529 | 10 ug |
$330.00
|
|
VC100032 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF6/7 [Human adenovirus 1], codon optimized for human cell expression, AP_000528 | 10 ug |
$165.00
|
|
VC100033 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF4 [Human adenovirus 1], codon optimized for human cell expression, AP_000530 | 10 ug |
$165.00
|
|
VC100034 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF3 [Human adenovirus 1], codon optimized for human cell expression, AP_000531 | 10 ug |
$165.00
|
|
VC100035 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF2 [Human adenovirus 1], codon optimized for human cell expression, AP_000532 | 10 ug |
$165.00
|
|
VC100036 | Myc-DDK-tagged ORF clone of viral ORF for E4 ORF1 [Human adenovirus 1], codon optimized for human cell expression, AP_000533 | 10 ug |
$165.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.