IX (AC_000017) Virus Tagged ORF Clone

SKU
VC100004
Myc-DDK-tagged ORF clone of viral ORF for IX [Human adenovirus 1], codon optimized for human cell expression, AP_000501
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$165.00
3 Weeks*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol IX
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>VC100004 representing AP_000501.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGAGTACAAATAGCTTTGACGGCTCTATCGTTAGCTCCTACCTGACAACACGGATGCCTCCCTGGGCC
GGAGTCAGACAAAATGTGATGGGGTCCTCAATCGACGGCAGGCCCGTGCTGCCCGCCAACTCTACTACA
TTGACATATGAGACTGTTTCTGGCACCCCCCTTGAGACTGCAGCGAGCGCTGCCGCTTCTGCAGCGGCG
GCCACTGCCAGAGGGATCGTCACTGACTTTGCTTTCCTCAGTCCCCTGGCAAGTAGCGCCGCTTCCAGA
TCCAGTGCACGGGACGACAAGCTGACTGCGTTGCTGGCCCAACTGGATTCATTGACCAGAGAGCTGAAC
GTGGTAAGCCAGCAGCTCCTGGAGCTTAGGCAACAGGTGAGTGCACTGAAGGCTTCAAGCCCACCAAAT
GCTGTT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
Protein Sequence
>VC100004 representing AP_000501
Blue=ORF Red=Cloning site Green=Tag(s)

MSTNSFDGSIVSSYLTTRMPPWAGVRQNVMGSSIDGRPVLPANSTTLTYETVSGTPLETAASAAASAAA
ATARGIVTDFAFLSPLASSAASRSSARDDKLTALLAQLDSLTRELNVVSQQLLELRQQVSALKASSPPN
AV

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN AC_000017
ORF Size 420 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq AP_000501
RefSeq ORF 420 bp
MW 14.5 kDa
Write Your Own Review
You're reviewing:IX (AC_000017) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC100001 Myc-DDK-tagged ORF clone of viral ORF for E1A [Human adenovirus 1], codon optimized for human cell expression, AP_000498 10 ug
$289.00 MSRP $300.00 MSRP $300.00
VC100002 Myc-DDK-tagged ORF clone of viral ORF for E1B 19K [Human adenovirus 1], codon optimized for human cell expression, AP_000499 10 ug
$330.00
VC100003 Myc-DDK-tagged ORF clone of viral ORF for E1B 55K [Human adenovirus 1], codon optimized for human cell expression, AP_000500 10 ug
$503.00
VC100005 Myc-DDK-tagged ORF clone of viral ORF for IVa2 [Human adenovirus 1], codon optimized for human cell expression, AP_000502 10 ug
$503.00
VC100007 Myc-DDK-tagged ORF clone of viral ORF for pTP [Human adenovirus 1], codon optimized for human cell expression, AP_000504 10 ug
$675.00
VC100008 Myc-DDK-tagged ORF clone of viral ORF for 52K [Human adenovirus 1], codon optimized for human cell expression, AP_000505 10 ug
$503.00
VC100009 Myc-DDK-tagged ORF clone of viral ORF for pIIIa [Human adenovirus 1], codon optimized for human cell expression, AP_000506 10 ug
$599.00
VC100010 Myc-DDK-tagged ORF clone of viral ORF for III [Human adenovirus 1], codon optimized for human cell expression, AP_000507 10 ug
$588.00
VC100011 Myc-DDK-tagged ORF clone of viral ORF for pVII [Human adenovirus 1], codon optimized for human cell expression, AP_000508 10 ug
$330.00
VC100012 Myc-DDK-tagged ORF clone of viral ORF for V [Human adenovirus 1], codon optimized for human cell expression, AP_000509 10 ug
$503.00
VC100013 Myc-DDK-tagged ORF clone of viral ORF for pX [Human adenovirus 1], codon optimized for human cell expression, AP_000510 10 ug
$165.00
VC100014 Myc-DDK-tagged ORF clone of viral ORF for pVI [Human adenovirus 1], codon optimized for human cell expression, AP_000511 10 ug
$330.00
VC100015 Myc-DDK-tagged ORF clone of viral ORF for hexon [Human adenovirus 1], codon optimized for human cell expression, AP_000512 10 ug
$971.00
VC100016 Myc-DDK-tagged ORF clone of viral ORF for protease [Human adenovirus 1], codon optimized for human cell expression, AP_000513 10 ug
$330.00
VC100017 Myc-DDK-tagged ORF clone of viral ORF for DBP [Human adenovirus 1], codon optimized for human cell expression, AP_000514 10 ug
$542.00
VC100018 Myc-DDK-tagged ORF clone of viral ORF for 100K [Human adenovirus 1], codon optimized for human cell expression, AP_000515 10 ug
$813.00
VC100019 Myc-DDK-tagged ORF clone of viral ORF for 33K [Human adenovirus 1], codon optimized for human cell expression, AP_000516 10 ug
$330.00
VC100020 Myc-DDK-tagged ORF clone of viral ORF for 22K [Human adenovirus 1], codon optimized for human cell expression, AP_000517 10 ug
$330.00
VC100021 Myc-DDK-tagged ORF clone of viral ORF for pVIII [Human adenovirus 1], codon optimized for human cell expression, AP_000518 10 ug
$330.00
VC100022 Myc-DDK-tagged ORF clone of viral ORF for E3 125K [Human adenovirus 1], codon optimized for human cell expression, AP_000519 10 ug
$165.00
VC100023 Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-alpha0 [Human adenovirus 1], codon optimized for human cell expression, AP_000520 10 ug
$165.00
VC100024 Myc-DDK-tagged ORF clone of viral ORF for E3 gp19K [Human adenovirus 1], codon optimized for human cell expression, AP_000521 10 ug
$165.00
VC100025 Myc-DDK-tagged ORF clone of viral ORF for E3 CR1-beta0 [Human adenovirus 1], codon optimized for human cell expression, AP_000522 10 ug
$165.00
VC100026 Myc-DDK-tagged ORF clone of viral ORF for E3 RID-alpha [Human adenovirus 1], codon optimized for human cell expression, AP_000523 10 ug
$165.00
VC100027 Myc-DDK-tagged ORF clone of viral ORF for E3 147K [Human adenovirus 1], codon optimized for human cell expression, AP_000525 10 ug
$165.00
VC100028 Myc-DDK-tagged ORF clone of viral ORF for E3 RID-beta [Human adenovirus 1], codon optimized for human cell expression, AP_000524 10 ug
$165.00
VC100029 Myc-DDK-tagged ORF clone of viral ORF for U exon, partial [Human adenovirus 1], codon optimized for human cell expression, AP_000526 10 ug
$165.00
VC100030 Myc-DDK-tagged ORF clone of viral ORF for fiber [Human adenovirus 1], codon optimized for human cell expression, AP_000527 10 ug
$596.00
VC100031 Myc-DDK-tagged ORF clone of viral ORF for E4 34K [Human adenovirus 1], codon optimized for human cell expression, AP_000529 10 ug
$330.00
VC100032 Myc-DDK-tagged ORF clone of viral ORF for E4 ORF6/7 [Human adenovirus 1], codon optimized for human cell expression, AP_000528 10 ug
$165.00
VC100033 Myc-DDK-tagged ORF clone of viral ORF for E4 ORF4 [Human adenovirus 1], codon optimized for human cell expression, AP_000530 10 ug
$165.00
VC100034 Myc-DDK-tagged ORF clone of viral ORF for E4 ORF3 [Human adenovirus 1], codon optimized for human cell expression, AP_000531 10 ug
$165.00
VC100035 Myc-DDK-tagged ORF clone of viral ORF for E4 ORF2 [Human adenovirus 1], codon optimized for human cell expression, AP_000532 10 ug
$165.00
VC100036 Myc-DDK-tagged ORF clone of viral ORF for E4 ORF1 [Human adenovirus 1], codon optimized for human cell expression, AP_000533 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.