RYK (NM_001005861) Human Tagged ORF Clone

SKU
RC600067
RYK (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens receptor-like tyrosine kinase, transcript variant 1, Signal peptide (1-25) plus EC domain (26-224)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RYK
Synonyms D3S3195; JTK5; JTK5A; RYK1
Vector pCMV6-XL5-DDK-His
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection None
Sequence Data
ORF Nucleotide Sequence
>RC600067 representing leader sequence plus the extracellular domain region of NM_001005861
Red=Cloning site Blue=ORF Green=Tags(s)

GTAATACGACTCACTATAGGGCGGCCGCGAATTCGTCGACTGGATCTGGTACCGAGGAGATCCGCCGCCG
CGATCGC
C

ATGCGTGGGGCGGCGCGGCTGGGGCGGCCGGGCCGGAGTTGCCTCCCGGGGGCCCGCGGCCTGAGGGCCC
CGCCGCCGCCGCCGCTGCTGCTTCTGCTTGCGCTGTTGCCGCTGCTGCCCGCGCCTGGCGCTGCCGCCGC
CCCCGCCCCGCGGCCCCCGGAGCTGCAGTCGGCTTCCGCGGGGCCCAGCGTGAGTCTCTACCTGAGCGAG
GACGAGGTGCGCCGGCTGATCGGTCTTGATGCAGAACTTTATTATGTGAGAAATGACCTTATTAGTCACT
ACGCTCTATCCTTTAGTCTGTTAGTACCCAGTGAGACAAATTTCCTGCACTTCACCTGGCATGCGAAGTC
CAAGGTTGAATATAAGCTGGGATTCCAAGTGGACAATGTTTTGGCAATGGATATGCCCCAGGTCAACATT
TCTGTTCAGGGGGAAGTTCCACGCACTTTATCAGTGTTTCGGGTAGAGCTTTCCTGTACTGGCAAAGTAG
ATTCTGAAGTTATGATACTAATGCAGCTCAACTTGACAGTAAATTCTTCAAAAAATTTTACCGTCTTAAA
TTTTAAACGAAGGAAAATGTGCTACAAAAAACTTGAAGAAGTAAAAACTTCAGCCTTGGACAAAAACACT
AGCAGAACTATTTATGATCCTGTACATGCAGCTCCAACCACTACGCGT


AGCGGACCGACGCGTTCAGGCGACTACAAGGATGACGACGATAAGGGATCTCATCATCACCATCACCATT
AA
TGAGATCTGGTACCGATATCAAGCTTGTCGACTCTAGA
Protein Sequence
>RC600067 representing signal peptide plus the extracellular domain region of NM_001005861
Red=Cloning sites Green= DDK and 6XHIS Tags

MRGAARLGRPGRSCLPGARGLRAPPPPPLLLLLALLPLLPAPGAAAAPAPRPPELQSASAGPSVSLYLSE
DEVRRLIGLDAELYYVRNDLISHYALSFSLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNI
SVQGEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNT
SRTIYDPVHAAPTTTR

SGPTRTRSGDYKDDDDKGSHHHHHH
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene
ACCN NM_001005861
ORF Size 678 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the extra cellular domain of the protein with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001005861.2, NP_001005861.1
RefSeq Size 2942 bp
RefSeq ORF 1833 bp
Locus ID 6259
UniProt ID P34925
Cytogenetics 3q22.2
Protein Families Druggable Genome, Protein Kinase, Transmembrane
MW 24.9 kDa
Summary The protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. The encoded protein has a leucine-rich extracellular domain with a WIF-type Wnt binding region, a single transmembrane domain, and an intracellular tyrosine kinase domain. This protein is involved in stimulating Wnt signaling pathways such as the regulation of axon pathfinding. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2012]
Write Your Own Review
You're reviewing:RYK (NM_001005861) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215449 RYK (Myc-DDK-tagged)-Human RYK receptor-like tyrosine kinase (RYK), transcript variant 1 10 ug
$568.00
RC215449L1 Lenti ORF clone of Human RYK receptor-like tyrosine kinase (RYK), transcript variant 1, Myc-DDK-tagged 10 ug
$868.00
RC215449L2 Lenti ORF clone of Human RYK receptor-like tyrosine kinase (RYK), transcript variant 1, mGFP tagged 10 ug
$868.00
RC215449L3 Lenti ORF clone of Human RYK receptor-like tyrosine kinase (RYK), transcript variant 1, Myc-DDK-tagged 10 ug
$868.00
RC215449L4 Lenti ORF clone of Human RYK receptor-like tyrosine kinase (RYK), transcript variant 1, mGFP tagged 10 ug
$868.00
RG215449 RYK (tGFP-tagged) - Human RYK receptor-like tyrosine kinase (RYK), transcript variant 1 10 ug
$768.00
SC301044 RYK (untagged)-Human RYK receptor-like tyrosine kinase (RYK), transcript variant 1 10 ug
$569.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.