TrkA (NTRK1) (NM_001012331) Human Tagged ORF Clone

SKU
RC600034
NTRK1 (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens neurotrophic tyrosine kinase, receptor, type 1, transcript variant 1, Signal peptide (1-32) plus EC domain (33-417)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TrkA
Synonyms MTC; p140-TrkA; TRK; Trk-A; TRK1; TRKA
Vector pCMV6-XL5-DDK-His
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection None
Sequence Data
ORF Nucleotide Sequence
>RC600034 representing leader sequence plus the extracellular domain region of NM_001012331
Red=Cloning site Blue=ORF Green=Tags(s)

GTAATACGACTCACTATAGGGCGGCCGCGAATTCGTCGACTGGATCTGGTACCGAGGAGATCCGCCGCCG
CGATCGC
C

ATGCTGCGAGGCGGACGGCGCGGGCAGCTTGGCTGGCACAGCTGGGCTGCGGGGCCGGGCAGCCTGCTGG
CTTGGCTGATACTGGCATCTGCGGGCGCCGCACCCTGCCCCGATGCCTGCTGCCCCCACGGCTCCTCGGG
ACTGCGATGCACCCGGGATGGGGCCCTGGATAGCCTCCACCACCTGCCCGGCGCAGAGAACCTGACTGAG
CTCTACATCGAGAACCAGCAGCATCTGCAGCATCTGGAGCTCCGTGATCTGAGGGGCCTGGGGGAGCTGA
GAAACCTCACCATCGTGAAGAGTGGTCTCCGTTTCGTGGCGCCAGATGCCTTCCATTTCACTCCTCGGCT
CAGTCGCCTGAATCTCTCCTTCAACGCTCTGGAGTCTCTCTCCTGGAAAACTGTGCAGGGCCTCTCCTTA
CAGGAACTGGTCCTGTCGGGGAACCCTCTGCACTGTTCTTGTGCCCTGCGCTGGCTACAGCGCTGGGAGG
AGGAGGGACTGGGCGGAGTGCCTGAACAGAAGCTGCAGTGTCATGGGCAAGGGCCCCTGGCCCACATGCC
CAATGCCAGCTGTGGTGTGCCCACGCTGAAGGTCCAGGTGCCCAATGCCTCGGTGGATGTGGGGGACGAC
GTGCTGCTGCGGTGCCAGGTGGAGGGGCGGGGCCTGGAGCAGGCCGGCTGGATCCTCACAGAGCTGGAGC
AGTCAGCCACGGTGATGAAATCTGGGGGTCTGCCATCCCTGGGGCTGACCCTGGCCAATGTCACCAGTGA
CCTCAACAGGAAGAACGTGACGTGCTGGGCAGAGAACGATGTGGGCCGGGCAGAGGTCTCTGTTCAGGTC
AACGTCTCCTTCCCGGCCAGTGTGCAGCTGCACACGGCGGTGGAGATGCACCACTGGTGCATCCCCTTCT
CTGTGGATGGGCAGCCGGCACCGTCTCTGCGCTGGCTCTTCAATGGCTCCGTGCTCAATGAGACCAGCTT
CATCTTCACTGAGTTCCTGGAGCCGGCAGCCAATGAGACCGTGCGGCACGGGTGTCTGCGCCTCAACCAG
CCCACCCACGTCAACAACGGCAACTACACGCTGCTGGCTGCCAACCCCTTCGGCCAGGCCTCCGCCTCCA
TCATGGCTGCCTTCATGGACAACCCTTTCGAGTTCAACCCCGAGGACCCCATCCCTGACACTAACAGCAC
ATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTGTGGGC


ACGCGTTCAGGCGACTACAAGGATGACGACGATAAGGGATCTCATCATCACCATCACCATTAATGAGATC
TGGTACCGATATCAAGCTTGTCGACTCTAGA
Protein Sequence
>RC600034 representing signal peptide plus the extracellular domain region of NM_001012331
Red=Cloning sites Green= DDK and 6XHIS Tags

MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTE
LYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSL
QELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQVPNASVDVGDD
VLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQV
NVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQ
PTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPDTNSTSGDPVEKKDETPFGVSVAVG

TRSGTRSGDYKDDDDKGSHHHHHH
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NM_001012331
ORF Size 1251 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the extra cellular domain of the protein with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001012331.1, NP_001012331.1
RefSeq Size 2647 bp
RefSeq ORF 2373 bp
Locus ID 4914
UniProt ID P04629
Cytogenetics 1q23.1
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Apoptosis, Endocytosis, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Thyroid cancer
MW 45.1 kDa
Summary This gene encodes a member of the neurotrophic tyrosine kinase receptor (NTKR) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, cognitive disability and cancer. Alternate transcriptional splice variants of this gene have been found, but only three have been characterized to date. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:TrkA (NTRK1) (NM_001012331) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213091 NTRK1 (Myc-DDK-tagged)-Human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1 10 ug
$1,085.00
RC213091L1 Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1, Myc-DDK-tagged 10 ug
$1,385.00
RC213091L2 Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1, mGFP tagged 10 ug
$1,385.00
RC213091L3 Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1, Myc-DDK-tagged 10 ug
$1,385.00
RC213091L4 Lenti ORF clone of Human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1, mGFP tagged 10 ug
$1,385.00
RG213091 NTRK1 (tGFP-tagged) - Human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1 10 ug
$789.00 MSRP $1,285.00 MSRP $1,285.00
SC126890 NTRK1 (untagged)-Human neurotrophic tyrosine kinase, receptor, type 1 (NTRK1), transcript variant 1 10 ug
$1,086.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.