CBWD3 (NM_201453) Human Tagged ORF Clone

CAT#: RC221698

CBWD3 (Myc-DDK-tagged)-Human COBW domain containing 3 (CBWD3)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CBWD3 (NM_201453) Human Tagged ORF Clone
Symbol CBWD3
Synonyms bA561O23.1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC221698 representing NM_201453
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTACCGGCTGTTGGATCTGCGGATGAGGAGGAGGATCCTGCGGAGGAGGATTGTCCTGAATTGGTTC
CCATGGAGACGACGCAAAGCGAGGAGGAGGAAAAGTCTGGCCTCGGCGCCAAGATCCCAGTCACAATTAT
CACCGGGTATTTAGGTGCTGGGAAGACAACACTTCTGAACTATATTTTGACAGAGCAACATAGTAAAAGA
GTAGCGGTCATTTTAAATGAATTTGGGGAAGGAAGTGCGCTGGAGAAATCCTTAGCTGTCAGCCAAGGTG
GAGAGCTCTATGAAGAGTGGCTGGAACTTAGAAACGGTTGCCTCTGCTGTTCAGTGAAGGACAATGGCCT
TAGAGCTATTGAGAATTTGATGCAAAAGAAGGGGAAATTTGATTACATACTGTTAGAGACCACTGGATTG
GCAGACCCAGGTGCAGTGGCTTCTATGTTTTGGGTTGATGCTGAATTAGGGAGTGATATTTACCTTGATG
GTATCATAACTATAGTGGATTCAAAATATGGATTAAAACATTTAGCAGAAGAGAAACCTGATGGCCTTAT
CAATGAAGCTACTAGGCAAGTTGCTTTGGCAGATGCCATTCTCATTAATAAAACAGACTTGGTTCCAGAA
GAAGATGTAAAGAAACTAAGAGCGACAATTAGATCCATAAATGGACTAGGACAAATCTTAGAAACACAAA
GATCAAGAGTTGATCTCTCTAATATATTAGATCTTCATGCCTTTGATAGTCTCTCTGGAATAAGTTTGCA
GAAAAAACTTCAGCATGTGCCAGGAACACAACCTCACCTTGATCAGAGTATTGTTACAATCACATTTGAA
GTACCAGGAAATGCAAAGGAAGAACATCTTAATATGTTTATTCAGAATCTCCTGTGGGAAAAGAATGTGA
GAAACAAGGACAATCACTGCATGGAGGTCATAAGGCTGAAGGGATTGGTGTCAATCAAAGACAAATCACA
ACAAGTGATTGTCCAGGGTGTCCATGAGCTCTATGATCTGGAGGAGACTCCAGTGAGCTGGAAGGATGAC
ACTGAGAGAACAAATCGATTGGTCCTCCTTGGCAGAAATTTAGATAAGGATATCCTTAAACAGCTGTTTA
TAGCTACTGTGACAGAAACAGAAAAGCAGTGGACAACACATTTCAAAGAAGATCAAGTTTGTACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC221698 representing NM_201453
Red=Cloning site Green=Tags(s)

MLPAVGSADEEEDPAEEDCPELVPMETTQSEEEEKSGLGAKIPVTIITGYLGAGKTTLLNYILTEQHSKR
VAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDNGLRAIENLMQKKGKFDYILLETTGL
ADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLAEEKPDGLINEATRQVALADAILINKTDLVPE
EDVKKLRATIRSINGLGQILETQRSRVDLSNILDLHAFDSLSGISLQKKLQHVPGTQPHLDQSIVTITFE
VPGNAKEEHLNMFIQNLLWEKNVRNKDNHCMEVIRLKGLVSIKDKSQQVIVQGVHELYDLEETPVSWKDD
TERTNRLVLLGRNLDKDILKQLFIATVTETEKQWTTHFKEDQVCT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_201453
ORF Size 1185 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_201453.1, NP_958861
RefSeq Size 1677
RefSeq ORF 1188
Locus ID 445571
Cytogenetics 9q21.11
MW 43.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations