CBWD3 (NM_201453) Human Tagged ORF Clone

CAT#: RG221698

Reviews ()
Write a review
  • TrueORF®

CBWD3 (GFP-tagged) - Human COBW domain containing 3 (CBWD3)

  View "NM_201453" in other vectors (10)

Reward yourself with an Amazon® Card when get any 3 cDNA clones.

USD 650.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name CBWD3 (NM_201453) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol CBWD3
Synonyms bA561O23.1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG221698 representing NM_201453
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTACCGGCTGTTGGATCTGCGGATGAGGAGGAGGATCCTGCGGAGGAGGATTGTCCTGAATTGGTTC
CCATGGAGACGACGCAAAGCGAGGAGGAGGAAAAGTCTGGCCTCGGCGCCAAGATCCCAGTCACAATTAT
CACCGGGTATTTAGGTGCTGGGAAGACAACACTTCTGAACTATATTTTGACAGAGCAACATAGTAAAAGA
GTAGCGGTCATTTTAAATGAATTTGGGGAAGGAAGTGCGCTGGAGAAATCCTTAGCTGTCAGCCAAGGTG
GAGAGCTCTATGAAGAGTGGCTGGAACTTAGAAACGGTTGCCTCTGCTGTTCAGTGAAGGACAATGGCCT
TAGAGCTATTGAGAATTTGATGCAAAAGAAGGGGAAATTTGATTACATACTGTTAGAGACCACTGGATTG
GCAGACCCAGGTGCAGTGGCTTCTATGTTTTGGGTTGATGCTGAATTAGGGAGTGATATTTACCTTGATG
GTATCATAACTATAGTGGATTCAAAATATGGATTAAAACATTTAGCAGAAGAGAAACCTGATGGCCTTAT
CAATGAAGCTACTAGGCAAGTTGCTTTGGCAGATGCCATTCTCATTAATAAAACAGACTTGGTTCCAGAA
GAAGATGTAAAGAAACTAAGAGCGACAATTAGATCCATAAATGGACTAGGACAAATCTTAGAAACACAAA
GATCAAGAGTTGATCTCTCTAATATATTAGATCTTCATGCCTTTGATAGTCTCTCTGGAATAAGTTTGCA
GAAAAAACTTCAGCATGTGCCAGGAACACAACCTCACCTTGATCAGAGTATTGTTACAATCACATTTGAA
GTACCAGGAAATGCAAAGGAAGAACATCTTAATATGTTTATTCAGAATCTCCTGTGGGAAAAGAATGTGA
GAAACAAGGACAATCACTGCATGGAGGTCATAAGGCTGAAGGGATTGGTGTCAATCAAAGACAAATCACA
ACAAGTGATTGTCCAGGGTGTCCATGAGCTCTATGATCTGGAGGAGACTCCAGTGAGCTGGAAGGATGAC
ACTGAGAGAACAAATCGATTGGTCCTCCTTGGCAGAAATTTAGATAAGGATATCCTTAAACAGCTGTTTA
TAGCTACTGTGACAGAAACAGAAAAGCAGTGGACAACACATTTCAAAGAAGATCAAGTTTGTACA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG221698 representing NM_201453
Red=Cloning site Green=Tags(s)

MLPAVGSADEEEDPAEEDCPELVPMETTQSEEEEKSGLGAKIPVTIITGYLGAGKTTLLNYILTEQHSKR
VAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDNGLRAIENLMQKKGKFDYILLETTGL
ADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLAEEKPDGLINEATRQVALADAILINKTDLVPE
EDVKKLRATIRSINGLGQILETQRSRVDLSNILDLHAFDSLSGISLQKKLQHVPGTQPHLDQSIVTITFE
VPGNAKEEHLNMFIQNLLWEKNVRNKDNHCMEVIRLKGLVSIKDKSQQVIVQGVHELYDLEETPVSWKDD
TERTNRLVLLGRNLDKDILKQLFIATVTETEKQWTTHFKEDQVCT

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_201453
ORF Size 1185 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_201453.1, NP_958861.1
RefSeq Size 1677
RefSeq ORF 1188
Locus ID 445571
Cytogenetics 9q21.11

Other Versions

Other products for "CBWD3"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00


Rabbit Polyclonal Anti-CBWD3 Antibody
    • 100 ul

USD 360.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones