CBWD3 Rabbit Polyclonal Antibody

CAT#: TA334814

Rabbit Polyclonal Anti-CBWD3 Antibody


 Product Datasheet for 'TA334814'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CBWD3 antibody is: synthetic peptide directed towards the C-terminal region of Human CBWD3. Synthetic peptide located within the following region: VQGVHELYDLEETPVSWKDDTERTNRLVLIGRNLDKDILKQLFIATVTET
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 43 kDa
Gene Name COBW domain containing 3
Background The function of this protein remains unknown.
Synonyms bA561O23.1
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 79%
Reference Data
Other products for "CBWD3"
Frequently bought together (2)
Transient overexpression lysate of COBW domain containing 3 (CBWD3)
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones