Glutaredoxin 1 (GLRX) (NM_002064) Human Tagged ORF Clone

SKU
RC219385
GLRX (Myc-DDK-tagged)-Human glutaredoxin (thioltransferase) (GLRX), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Glutaredoxin 1
Synonyms GRX; GRX1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219385 representing NM_002064
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCAAGAGTTTGTGAACTGCAAAATCCAGCCTGGGAAGGTGGTTGTGTTCATCAAGCCCACCTGCC
CGTACTGCAGGAGGGCCCAAGAGATCCTCAGTCAATTGCCCATCAAACAAGGGCTTCTGGAATTTGTCGA
TATCACAGCCACCAACCACACTAACGAGATTCAAGATTATTTGCAACAGCTCACGGGAGCAAGAACGGTG
CCTCGAGTCTTTATCGGTAAAGATTGTATAGGCGGATGCAGTGATCTAGTCTCTTTGCAACAGAGTGGGG
AACTGCTGACGCGGCTAAAGCAGATTGGAGCTCTGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219385 representing NM_002064
Red=Cloning site Green=Tags(s)

MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTV
PRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002064
ORF Size 318 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002064.3
RefSeq Size 1328 bp
RefSeq ORF 321 bp
Locus ID 2745
UniProt ID P35754
Cytogenetics 5q15
Domains glutaredoxin
Protein Families Druggable Genome
MW 11.6 kDa
Summary This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial for several signalling pathways by controlling the S-glutathionylation status of signalling mediators. It is involved in beta-amyloid toxicity and Alzheimer's disease. Multiple alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:Glutaredoxin 1 (GLRX) (NM_002064) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219385L1 Lenti ORF clone of Human glutaredoxin (thioltransferase) (GLRX), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC219385L2 Lenti ORF clone of Human glutaredoxin (thioltransferase) (GLRX), transcript variant 1, mGFP tagged 10 ug
$450.00
RC219385L3 Lenti ORF clone of Human glutaredoxin (thioltransferase) (GLRX), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC219385L4 Lenti ORF clone of Human glutaredoxin (thioltransferase) (GLRX), transcript variant 1, mGFP tagged 10 ug
$450.00
RG219385 GLRX (tGFP-tagged) - Human glutaredoxin (thioltransferase) (GLRX), transcript variant 1 10 ug
$489.00
SC118879 GLRX (untagged)-Human glutaredoxin (thioltransferase) (GLRX), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.