MSRB2 (NM_012228) Human Tagged ORF Clone

SKU
RC215002
MSRB2 (Myc-DDK-tagged)-Human methionine sulfoxide reductase B2 (MSRB2)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MSRB2
Synonyms CBS-1; CBS1; CGI-131; MSRB; PILB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215002 representing NM_012228
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAGCAGGGGCAGAGACGGGCAGAGGGCAGAGGGCGGCAGCGCCGGAGCGGCGTCATGGCCGGCTCC
TCTGGTTGCTCCGGGGCCTGACCCTCGGAACTGCGCCTCGGCGGGCGGTGCGGGGCCAAGCGGGCGGCGG
CGGGCCCGGCACCGCGGGGATCGTGGGGGAGGCAGGGTCTCTTGCAACGTGTGAGCTGCCTCTTGCCAAG
AGTGAGTGGCAAAAGAAACTAACCCCGGAGCAGTTCTACGTCACAAGAGAAAAGGGAACGGAACCGCCTT
TCAGTGGGATCTACCTGAATAACAAGGAAGCAGGAATGTATCATTGCGTGTGCTGCGACAGTCCACTCTT
CAGTTCTGAGAAAAAGTACTGCTCTGGCACTGGGTGGCCTTCGTTTTCTGAGGCTCATGGTACGTCTGGC
TCTGATGAAAGCCACACAGGGATCCTGAGACGTCTGGATACCTCGTTAGGATCAGCTCGCACAGAGGTTG
TCTGCAAGCAGTGTGAAGCTCATCTAGGTCACGTGTTTCCTGATGGACCTGGGCCCAATGGTCAGAGGTT
TTGCATCAACAGTGTGGCTTTGAAGTTCAAACCAAGGAAACAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215002 representing NM_012228
Red=Cloning site Green=Tags(s)

MGAGAETGRGQRAAAPERRHGRLLWLLRGLTLGTAPRRAVRGQAGGGGPGTAGIVGEAGSLATCELPLAK
SEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSG
SDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_012228
ORF Size 603 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012228.2, NP_036360.2
RefSeq Size 903 bp
RefSeq ORF 549 bp
Locus ID 22921
UniProt ID Q9Y3D2
Cytogenetics 10p12.2
Domains SelR
Protein Families Transcription Factors
MW 21.47 kDa
Summary Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:MSRB2 (NM_012228) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215002L3 Lenti-ORF clone of MSRB2 (Myc-DDK-tagged)-Human methionine sulfoxide reductase B2 (MSRB2) 10 ug
$600.00
RC215002L4 Lenti-ORF clone of MSRB2 (mGFP-tagged)-Human methionine sulfoxide reductase B2 (MSRB2) 10 ug
$600.00
RG215002 MSRB2 (tGFP-tagged) - Human methionine sulfoxide reductase B2 (MSRB2) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC127636 MSRB2 (untagged)-Human methionine sulfoxide reductase B2 (MSRB2) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.