Catalase(CAT) (NM_001752) Human Tagged ORF Clone

CAT#: RC210763

CAT (Myc-DDK-tagged)-Human catalase (CAT)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 5 publications.

Product images

Specifications

Product Data
Product Name Catalase(CAT) (NM_001752) Human Tagged ORF Clone
Symbol CAT
Synonyms MGC138422; MGC138424
Vector pCMV6-Entry
Sequence Data
>RC210763 representing NM_001752
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGACAGCCGGGATCCCGCCAGCGACCAGATGCAGCACTGGAAGGAGCAGCGGGCCGCGCAGAAAG
CTGATGTCCTGACCACTGGAGCTGGTAACCCAGTAGGAGACAAACTTAATGTTATTACAGTAGGGCCCCG
TGGGCCCCTTCTTGTTCAGGATGTGGTTTTCACTGATGAAATGGCTCATTTTGACCGAGAGAGAATTCCT
GAGAGAGTTGTGCATGCTAAAGGAGCAGGGGCCTTTGGCTACTTTGAGGTCACACATGACATTACCAAAT
ACTCCAAGGCAAAGGTATTTGAGCATATTGGAAAGAAGACTCCCATCGCAGTTCGGTTCTCCACTGTTGC
TGGAGAATCGGGTTCAGCTGACACAGTTCGGGACCCTCGTGGGTTTGCAGTGAAATTTTACACAGAAGAT
GGTAACTGGGATCTCGTTGGAAATAACACCCCCATTTTCTTCATCAGGGATCCCATATTGTTTCCATCTT
TTATCCACAGCCAAAAGAGAAATCCTCAGACACATCTGAAGGATCCGGACATGGTCTGGGACTTCTGGAG
CCTACGTCCTGAGTCTCTGCATCAGGTTTCTTTCTTGTTCAGTGATCGGGGGATTCCAGATGGACATCGC
CACATGAATGGATATGGATCACATACTTTCAAGCTGGTTAATGCAAATGGGGAGGCAGTTTATTGCAAAT
TCCATTATAAGACTGACCAGGGCATCAAAAACCTTTCTGTTGAAGATGCGGCGAGACTTTCCCAGGAAGA
TCCTGACTATGGCATCCGGGATCTTTTTAACGCCATTGCCACAGGAAAGTACCCCTCCTGGACTTTTTAC
ATCCAGGTCATGACATTTAATCAGGCAGAAACTTTTCCATTTAATCCATTCGATCTCACCAAGGTTTGGC
CTCACAAGGACTACCCTCTCATCCCAGTTGGTAAACTGGTCTTAAACCGGAATCCAGTTAATTACTTTGC
TGAGGTTGAACAGATAGCCTTCGACCCAAGCAACATGCCACCTGGCATTGAGGCCAGTCCTGACAAAATG
CTTCAGGGCCGCCTTTTTGCCTATCCTGACACTCACCGCCATCGCCTGGGACCCAATTATCTTCATATAC
CTGTGAACTGTCCCTACCGTGCTCGAGTGGCCAACTACCAGCGTGATGGCCCGATGTGCATGCAGGACAA
TCAGGGTGGTGCTCCAAATTACTACCCCAACAGCTTTGGTGCTCCGGAACAACAGCCTTCTGCCCTGGAG
CACAGCATCCAATATTCTGGAGAAGTGCGGAGATTCAACACTGCCAATGATGATAACGTTACTCAGGTGC
GGGCATTCTATGTGAACGTGCTGAATGAGGAACAGAGGAAACGTCTGTGTGAGAACATTGCCGGCCACCT
GAAGGATGCACAAATTTTCATCCAGAAGAAAGCGGTCAAGAACTTCACTGAGGTCCACCCTGACTACGGG
AGCCACATCCAGGCTCTTCTGGACAAGTACAATGCTGAGAAGCCTAAGAATGCGATTCACACCTTTGTGC
AGTCCGGATCTCACTTGGCGGCAAGGGAGAAGGCAAATCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210763 representing NM_001752
Red=Cloning site Green=Tags(s)

MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIP
ERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTED
GNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHR
HMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFY
IQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKM
LQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALE
HSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYG
SHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKANL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001752
ORF Size 1581 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001752.1, NM_001752.2, NM_001752.3, NP_001743
RefSeq Size 2305
RefSeq ORF 1584
Locus ID 847
Cytogenetics 11p13
Domains catalase
Protein Families Druggable Genome
Protein Pathways Tryptophan metabolism, Methane metabolism, Metabolic pathways, Amyotrophic lateral sclerosis (ALS)
MW 59.6 kDa
Gene Summary This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide to water and oxygen and thereby mitigates the toxic effects of hydrogen peroxide. Oxidative stress is hypothesized to play a role in the development of many chronic or late-onset diseases such as diabetes, asthma, Alzheimer's disease, systemic lupus erythematosus, rheumatoid arthritis, and cancers. Polymorphisms in this gene have been associated with decreases in catalase activity but, to date, acatalasemia is the only disease known to be caused by this gene. [provided by RefSeq, Oct 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (5)