Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Tagged ORF Clone

SKU
RC208964
SBDS (Myc-DDK-tagged)-Human Shwachman-Bodian-Diamond syndrome (SBDS)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Shwachman Bodian Diamond syndrome
Synonyms CGI-97; SDO1; SDS; SWDS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208964 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGATCTTCACCCCCACCAACCAGATCCGCCTAACCAATGTGGCCGTGGTACGGATGAAGCGTGCCG
GGAAGCGCTTCGAAATCGCCTGCTACAAAAACAAGGTCGTCGGCTGGCGGAGCGGCGTGGAAAAAGACCT
CGATGAAGTTCTGCAGACCCACTCAGTGTTTGTAAATGTTTCTAAAGGTCAGGTTGCCAAAAAGGAAGAT
CTCATCAGTGCGTTTGGAACAGATGACCAAACTGAAATCTGTAAGCAGATTTTGACTAAAGGAGAAGTTC
AAGTATCAGATAAAGAAAGACACACACAACTGGAGCAGATGTTTAGGGACATTGCAACTATTGTGGCAGA
CAAATGTGTGAATCCTGAAACAAAGAGACCATACACCGTGATCCTTATTGAGAGAGCCATGAAGGACATC
CACTATTCGGTGAAAACCAACAAGAGTACAAAACAGCAGGCTTTGGAAGTGATAAAGCAGTTAAAAGAGA
AAATGAAGATAGAACGTGCTCACATGAGGCTTCGGTTCATCCTTCCAGTCAATGAAGGCAAGAAGCTGAA
AGAAAAGCTCAAGCCACTGATCAAGGTCATAGAAAGTGAAGATTATGGCCAACAGTTAGAAATCGTATGT
CTGATTGACCCGGGCTGCTTCCGAGAAATTGATGAGCTAATAAAAAAGGAAACTAAAGGCAAAGGTTCTT
TGGAAGTACTCAATCTGAAAGATGTAGAAGAAGGAGATGAGAAATTTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208964 protein sequence
Red=Cloning site Green=Tags(s)

MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKED
LISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDI
HYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVC
LIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016038
ORF Size 750 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016038.4
RefSeq Size 1605 bp
RefSeq ORF 753 bp
Locus ID 51119
UniProt ID Q9Y3A5
Cytogenetics 7q11.21
Domains UPF0023
MW 28.8 kDa
Summary This gene encodes a highly conserved protein that plays an essential role in ribosome biogenesis. The encoded protein interacts with elongation factor-like GTPase 1 to disassociate eukaryotic initiation factor 6 from the late cytoplasmic pre-60S ribosomal subunit allowing assembly of the 80S subunit. Mutations within this gene are associated with the autosomal recessive disorder Shwachman-Bodian-Diamond syndrome. This gene has a closely linked pseudogene that is distally located. [provided by RefSeq, Jan 2017]
Write Your Own Review
You're reviewing:Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208964L3 Lenti ORF clone of Human Shwachman-Bodian-Diamond syndrome (SBDS), Myc-DDK-tagged 10 ug
$600.00
RC208964L4 Lenti ORF clone of Human Shwachman-Bodian-Diamond syndrome (SBDS), mGFP tagged 10 ug
$600.00
RG208964 SBDS (tGFP-tagged) - Human Shwachman-Bodian-Diamond syndrome (SBDS) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC114508 SBDS (untagged)-Human Shwachman-Bodian-Diamond syndrome (SBDS) 10 ug
$300.00
SC321991 SBDS (untagged)-Human Shwachman-Bodian-Diamond syndrome (SBDS) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.