NKX2.8 (NKX2-8) (NM_014360) Human Tagged ORF Clone

SKU
RC207752
NKX2 (Myc-DDK-tagged)-Human NK2 homeobox 8 (NKX2-8)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NKX2.8
Synonyms Nkx2-9; NKX2.8; NKX2H
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207752 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACCTCTGGACGCCTGAGCTTCACCGTGCGCAGCCTTCTAGATTTACCCGAGCAGGACGCGCAAC
ACCTGCCGAGGCGGGAGCCAGAACCACGCGCCCCCCAGCCCGACCCCTGCGCCGCCTGGCTGGATTCGGA
GCGCGGCCACTACCCTTCCTCGGACGAGAGCAGCCTGGAGACCAGCCCGCCAGACTCGTCGCAGCGGCCG
TCCGCTAGGCCCGCGTCTCCGGGCTCGGACGCCGAGAAAAGGAAGAAGCGGCGGGTGCTATTCTCCAAGG
CGCAGACGCTGGAGTTGGAGCGGCGCTTCCGGCAGCAGCGGTACCTGTCTGCGCCCGAGCGCGAGCAGCT
GGCGAGCCTGCTTCGCCTCACGCCCACGCAGGTCAAGATCTGGTTCCAGAATCATCGCTACAAGCTGAAG
CGCGCTCGCGCTCCAGGGGCGGCGGAGTCGCCTGACCTGGCAGCATCCGCCGAGCTGCACGCCGCGCCCG
GCCTGCTGCGTCGCGTGGTGGTGCCGGTGCTTGTTCGCGACGGGCAGCCGTGCGGCGGCGGCGGCGGTGG
CGAGGTGGGAACCGCCGCGGCCCAGGAGAAGTGCGGCGCCCCTCCAGCCGCCGCCTGCCCTCTGCCGGGC
TACCCTGCCTTCGGTCCCGGCTCGGCGCTTGGCCTCTTCCCCGCCTACCAGCACTTAGCATCCCCCGCCC
TGGTCTCCTGGAACTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207752 protein sequence
Red=Cloning site Green=Tags(s)

MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRP
SARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLK
RARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQPCGGGGGGEVGTAAAQEKCGAPPAAACPLPG
YPAFGPGSALGLFPAYQHLASPALVSWNW

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014360
ORF Size 717 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014360.4
RefSeq Size 1857 bp
RefSeq ORF 720 bp
Locus ID 26257
UniProt ID O15522
Cytogenetics 14q13.3
Protein Families Druggable Genome, Transcription Factors
MW 25.9 kDa
Summary The protein encoded by this gene is a homeobox-containing developmental regulator associated with liver development. The encoded protein binds to the alpha-fetoprotein (AFP) gene promoter and increases the expression of AFP. This gene is overexpressed in some lung cancers and is linked to poor patient survival, possibly due to its resistance to cisplatin. This gene is aberrantly methylated in pancreatic cancer, deleted in squamous cell lung carcinomas, and acts as a tumor suppressor in esophageal cancer. Mutations in this gene may also be a cause of neural tube defects. [provided by RefSeq, Dec 2015]
Write Your Own Review
You're reviewing:NKX2.8 (NKX2-8) (NM_014360) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207752L1 Lenti ORF clone of Human NK2 homeobox 8 (NKX2-8), Myc-DDK-tagged 10 ug
$600.00
RC207752L2 Lenti ORF clone of Human NK2 homeobox 8 (NKX2-8), mGFP tagged 10 ug
$600.00
RC207752L3 Lenti ORF clone of Human NK2 homeobox 8 (NKX2-8), Myc-DDK-tagged 10 ug
$600.00
RC207752L4 Lenti ORF clone of Human NK2 homeobox 8 (NKX2-8), mGFP tagged 10 ug
$600.00
RG207752 NKX2 (tGFP-tagged) - Human NK2 homeobox 8 (NKX2-8) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC304088 NKX2 (untagged)-Human NK2 homeobox 8 (NKX2-8) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.