LZTFL1 (NM_020347) Human Tagged ORF Clone

SKU
RC207289
LZTFL1 (Myc-DDK-tagged)-Human leucine zipper transcription factor-like 1 (LZTFL1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LZTFL1
Synonyms BBS17
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207289 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAGTTGGGCCTAAATGAGCACCATCAAAATGAAGTTATTAATTATATGCGTTTTGCTCGTTCAA
AGAGAGGCTTGAGACTCAAAACTGTAGATTCCTGCTTCCAAGACCTCAAGGAGAGCAGGCTGGTGGAGGA
CACCTTCACCATAGATGAAGTCTCTGAAGTCCTCAATGGATTACAAGCTGTGGTTCATAGTGAGGTGGAA
TCTGAGCTCATCAACACTGCCTATACCAATGTGTTACTTCTGCGACAGCTGTTTGCACAAGCTGAGAAGT
GGTATCTTAAGCTACAGACAGACATCTCTGAACTTGAAAACCGAGAATTATTAGAACAAGTTGCAGAATT
TGAAAAAGCAGAGATTACATCTTCAAACAAAAAGCCCATCTTAGATGTCACAAAGCCAAAACTTGCTCCA
CTTAATGAAGGTGGAACAGCAGAACTCCTAAACAAGGAAATTTTAAGACTTCAAGAAGAGAATGAGAAAT
TGAAGTCAAGGTTGAAGACCATTGAAATACAGGCTACAAATGCACTGGATGAAAAGTCAAAACTAGAAAA
AGCACTGCAAGATTTACAGCTTGATCAAGGAAATCAAAAGGATTTTATAAAGGCCCAAGACTTAAGTAAC
TTAGAAAACACTGTCGCTGCCTTAAAGAGTGAGTTTCAGAAGACACTTAATGACAAGACAGAAAACCAGA
AGTCACTGGAGGAGAATCTGGCGACAGCCAAGCACGATCTACTCAGGGTTCAGGAGCAGCTGCACATGGC
TGAAAAGGAATTAGAAAAGAAATTTCAGCAAACAGCAGCTTATCGAAACATGAAAGAGATTCTTACCAAG
AAGAATGACCAAATCAAAGATCTGAGGAAAAGACTGGCACAATATGAACCTGAAGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207289 protein sequence
Red=Cloning site Green=Tags(s)

MAELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEDTFTIDEVSEVLNGLQAVVHSEVE
SELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAP
LNEGGTAELLNKEILRLQEENEKLKSRLKTIEIQATNALDEKSKLEKALQDLQLDQGNQKDFIKAQDLSN
LENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTK
KNDQIKDLRKRLAQYEPED

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020347
ORF Size 897 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020347.4
RefSeq Size 4075 bp
RefSeq ORF 900 bp
Locus ID 54585
UniProt ID Q9NQ48
Cytogenetics 3p21.31
Protein Families Transcription Factors
MW 34.6 kDa
Summary This gene encodes a ubiquitously expressed protein that localizes to the cytoplasm. This protein interacts with Bardet-Biedl Syndrome (BBS) proteins and, through its interaction with BBS protein complexes, regulates protein trafficking to the ciliary membrane. Nonsense mutations in this gene cause a form of Bardet-Biedl Syndrome; a ciliopathy characterized in part by polydactyly, obesity, cognitive impairment, hypogonadism, and kidney failure. This gene may also function as a tumor suppressor; possibly by interacting with E-cadherin and the actin cytoskeleton and thereby regulating the transition of epithelial cells to mesenchymal cells. [provided by RefSeq, Aug 2020]
Write Your Own Review
You're reviewing:LZTFL1 (NM_020347) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC207289L1 Lenti ORF clone of Human leucine zipper transcription factor-like 1 (LZTFL1), Myc-DDK-tagged 10 ug
$600.00
RC207289L2 Lenti ORF clone of Human leucine zipper transcription factor-like 1 (LZTFL1), mGFP tagged 10 ug
$600.00
RC207289L3 Lenti ORF clone of Human leucine zipper transcription factor-like 1 (LZTFL1), Myc-DDK-tagged 10 ug
$600.00
RC207289L4 Lenti ORF clone of Human leucine zipper transcription factor-like 1 (LZTFL1), mGFP tagged 10 ug
$600.00
RG207289 LZTFL1 (tGFP-tagged) - Human leucine zipper transcription factor-like 1 (LZTFL1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC113133 LZTFL1 (untagged)-Human leucine zipper transcription factor-like 1 (LZTFL1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.