HPGDS (NM_014485) Human Tagged ORF Clone

SKU
RC204725
HPGDS (Myc-DDK-tagged)-Human hematopoietic prostaglandin D synthase (HPGDS)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HPGDS
Synonyms GSTS; GSTS1; GSTS1-1; PGD2; PGDS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204725 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAAACTACAAACTCACTTATTTTAATATGAGGGGGAGAGCAGAAATTATTCGTTACATATTTGCTT
ATTTGGACATACAGTATGAAGACCACAGAATAGAACAAGCTGACTGGCCTGAAATCAAATCAACTCTCCC
ATTTGGAAAAATCCCCATTTTGGAAGTTGATGGACTTACTCTTCACCAGAGCCTAGCAATAGCAAGATAT
TTGACCAAAAACACAGATTTGGCTGGAAACACAGAAATGGAACAATGTCATGTTGATGCTATTGTGGACA
CTCTGGATGATTTCATGTCATGTTTTCCTTGGGCAGAGAAAAAGCAAGATGTGAAAGAGCAGATGTTCAA
TGAGCTGCTCACGTATAATGCGCCTCATCTTATGCAAGACTTGGACACATATTTAGGGGGGAGAGAATGG
CTTATTGGTAACTCTGTAACTTGGGCAGACTTCTACTGGGAGATTTGCAGTACCACACTTTTGGTCTTTA
AGCCTGACCTGTTAGACAACCATCCAAGGCTGGTGACTTTACGGAAGAAAGTCCAAGCCATTCCTGCCGT
CGCTAACTGGATAAAACGAAGGCCCCAAACCAAACTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204725 protein sequence
Red=Cloning site Green=Tags(s)

MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARY
LTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREW
LIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014485
ORF Size 597 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014485.3
RefSeq Size 1615 bp
RefSeq ORF 600 bp
Locus ID 27306
UniProt ID O60760
Cytogenetics 4q22.3
Domains GST_C, GST_N
Protein Pathways Arachidonic acid metabolism, Metabolic pathways
MW 23.3 kDa
Summary Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:HPGDS (NM_014485) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204725L1 Lenti ORF clone of Human hematopoietic prostaglandin D synthase (HPGDS), Myc-DDK-tagged 10 ug
$600.00
RC204725L2 Lenti ORF clone of Human hematopoietic prostaglandin D synthase (HPGDS), mGFP tagged 10 ug
$600.00
RC204725L3 Lenti ORF clone of Human hematopoietic prostaglandin D synthase (HPGDS), Myc-DDK-tagged 10 ug
$600.00
RC204725L4 Lenti ORF clone of Human hematopoietic prostaglandin D synthase (HPGDS), mGFP tagged 10 ug
$600.00
RG204725 HPGDS (tGFP-tagged) - Human hematopoietic prostaglandin D synthase (HPGDS) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC114983 HPGDS (untagged)-Human hematopoietic prostaglandin D synthase (HPGDS) 10 ug
$300.00
SC324532 HPGDS (untagged)-Human hematopoietic prostaglandin D synthase (HPGDS) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.