HPGDS Rabbit Polyclonal Antibody

SKU TA346774

Rabbit Polyclonal Anti-PGDS Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PGDS antibody: synthetic peptide directed towards the N terminal of human PGDS. Synthetic peptide located within the following region: EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 23 kDa
• Gene Name: hematopoietic prostaglandin D synthase
• Database Link:
  NP_055300
  O60760
• Background: Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. [provided by RefSeq, Jul 2008]
• Synonyms: GSTS; GSTS1; GSTS1-1; PGD2; PGDS
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%

Reference Data

• Protein Pathways: Arachidonic acid metabolism, Metabolic pathways