SH2D1A (NM_002351) Human Tagged ORF Clone

SKU
RC204723
SH2D1A (Myc-DDK-tagged)-Human SH2 domain containing 1A (SH2D1A), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SH2D1A
Synonyms DSHP; EBVS; IMD5; LYP; MTCP1; SAP; SAP/SH2D1A; XLP; XLPD; XLPD1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204723 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGCAGTGGCTGTGTATCATGGCAAAATCAGCAGGGAAACCGGCGAGAAGCTCCTGCTTGCCACTG
GGCTGGATGGCAGCTATTTGCTGAGGGACAGCGAGAGCGTGCCAGGCGTGTACTGCCTATGTGTGCTGTA
TCACGGTTACATTTATACATACCGAGTGTCCCAGACAGAAACAGGTTCTTGGAGTGCTGAGACAGCACCT
GGGGTACATAAAAGATATTTCCGGAAAATAAAAAATCTCATTTCAGCATTTCAGAAGCCAGATCAAGGCA
TTGTAATACCTCTGCAGTATCCAGTTGAGAAGAAGTCCTCAGCTAGAAGTACACAAGGTACTACAGGGAT
AAGAGAAGATCCTGATGTCTGCCTGAAAGCCCCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204723 protein sequence
Red=Cloning site Green=Tags(s)

MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAP
GVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002351
ORF Size 384 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002351.5
RefSeq Size 2523 bp
RefSeq ORF 387 bp
Locus ID 4068
UniProt ID O60880
Cytogenetics Xq25
Domains SH2
Protein Families Druggable Genome
Protein Pathways Natural killer cell mediated cytotoxicity
MW 14.2 kDa
Summary This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SH2D1A (NM_002351) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204723L1 Lenti ORF clone of Human SH2 domain containing 1A (SH2D1A), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC204723L2 Lenti ORF clone of Human SH2 domain containing 1A (SH2D1A), transcript variant 1, mGFP tagged 10 ug
$450.00
RC204723L3 Lenti ORF clone of Human SH2 domain containing 1A (SH2D1A), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC204723L4 Lenti ORF clone of Human SH2 domain containing 1A (SH2D1A), transcript variant 1, mGFP tagged 10 ug
$450.00
RG204723 SH2D1A (tGFP-tagged) - Human SH2 domain containing 1A (SH2D1A), transcript variant 1 10 ug
$489.00
SC118690 SH2D1A (untagged)-Human SH2 domain containing 1A (SH2D1A), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.