CDK2AP1 (NM_004642) Human Tagged ORF Clone
SKU
RC204442
CDK2AP1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | CDK2AP1 |
Synonyms | doc-1; DOC1; DORC1; p12DOC-1; ST19 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC204442 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCTTACAAACCGAACTTGGCCGCGCACATGCCCGCCGCCGCCCTCAACGCCGCTGGGAGTGTCCACT CGCCTTCCACCAGCATGGCAACGTCTTCACAGTACCGCCAGCTGCTCAGTGACTACGGGCCACCGTCCCT AGGCTACACCCAGGGAACTGGGAACAGCCAGGTGCCCCAAAGCAAATACGCGGAGCTGCTGGCCATCATT GAAGAGCTGGGGAAGGAGATCAGACCCACGTACGCAGGGAGCAAGAGTGCCATGGAGAGGCTGAAGCGCG GCATCATTCACGCTAGAGGACTGGTTCGGGAGTGCTTGGCAGAAACGGAACGGAATGCCAGATCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204442 protein sequence
Red=Cloning site Green=Tags(s) MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAII EELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_004642 |
ORF Size | 345 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_004642.4 |
RefSeq Size | 1655 bp |
RefSeq ORF | 348 bp |
Locus ID | 8099 |
UniProt ID | O14519 |
Cytogenetics | 12q24.31 |
MW | 12.4 kDa |
Summary | The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC204442L1 | Lenti ORF clone of Human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC204442L2 | Lenti ORF clone of Human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1), mGFP tagged | 10 ug |
$450.00
|
|
RC204442L3 | Lenti ORF clone of Human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1), Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC204442L4 | Lenti ORF clone of Human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1), mGFP tagged | 10 ug |
$450.00
|
|
RG204442 | CDK2AP1 (tGFP-tagged) - Human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1) | 10 ug |
$350.00
|
|
SC117244 | CDK2AP1 (untagged)-Human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1) | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.