CDK2AP1 (NM_004642) Human Tagged ORF Clone

SKU
RG204442
CDK2AP1 (tGFP-tagged) - Human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CDK2AP1
Synonyms doc-1; DOC1; DORC1; p12DOC-1; ST19
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG204442 representing NM_004642
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTACAAACCGAACTTGGCCGCGCACATGCCCGCCGCCGCCCTCAACGCCGCTGGGAGTGTCCACT
CGCCTTCCACCAGCATGGCAACGTCTTCACAGTACCGCCAGCTGCTCAGTGACTACGGGCCACCGTCCCT
AGGCTACACCCAGGGAACTGGGAACAGCCAGGTGCCCCAAAGCAAATACGCGGAGCTGCTGGCCATCATT
GAAGAGCTGGGGAAGGAGATCAGACCCACGTACGCAGGGAGCAAGAGTGCCATGGAGAGGCTGAAGCGCG
GCATCATTCACGCTAGAGGACTGGTTCGGGAGTGCTTGGCAGAAACGGAACGGAATGCCAGATCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204442 representing NM_004642
Red=Cloning site Green=Tags(s)

MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAII
EELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004642
ORF Size 345 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004642.4
RefSeq Size 1627 bp
RefSeq ORF 348 bp
Locus ID 8099
UniProt ID O14519
Cytogenetics 12q24.31
Summary The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012]
Write Your Own Review
You're reviewing:CDK2AP1 (NM_004642) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204442 CDK2AP1 (Myc-DDK-tagged)-Human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1) 10 ug
$150.00
RC204442L1 Lenti ORF clone of Human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1), Myc-DDK-tagged 10 ug
$450.00
RC204442L2 Lenti ORF clone of Human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1), mGFP tagged 10 ug
$450.00
RC204442L3 Lenti ORF clone of Human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1), Myc-DDK-tagged 10 ug
$450.00
RC204442L4 Lenti ORF clone of Human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1), mGFP tagged 10 ug
$450.00
SC117244 CDK2AP1 (untagged)-Human cyclin-dependent kinase 2 associated protein 1 (CDK2AP1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.