DNAJB4 (NM_007034) Human Tagged ORF Clone

SKU
RC203743
DNAJB4 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 4 (DNAJB4)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DNAJB4
Synonyms DjB4; DNAJW; HLJ1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203743 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAAAGACTATTATTGCATTTTGGGAATTGAGAAAGGAGCTTCAGATGAAGATATTAAAAAGGCTT
ACCGAAAACAAGCCCTCAAATTTCATCCGGACAAGAACAAATCTCCTCAGGCAGAGGAAAAATTTAAAGA
GGTCGCAGAAGCTTATGAAGTATTGAGTGATCCTAAAAAGAGAGAAATATATGATCAGTTTGGGGAGGAA
GGGTTGAAAGGAGGAGCAGGAGGTACTGATGGACAAGGAGGTACCTTCCGGTACACCTTTCATGGCGATC
CTCATGCTACATTTGCTGCATTTTTCGGAGGGTCCAACCCCTTTGAAATTTTCTTTGGAAGACGAATGGG
TGGTGGTAGAGATTCTGAAGAAATGGAAATAGATGGTGATCCTTTTAGTGCCTTTGGTTTCAGCATGAAT
GGATATCCAAGAGACAGGAATTCTGTGGGGCCATCCCGCCTCAAACAAGATCCTCCAGTTATTCATGAAC
TTAGAGTATCACTTGAAGAGATATATAGTGGTTGTACCAAACGGATGAAGATTTCTCGAAAAAGGCTAAA
CGCTGATGGAAGGAGTTACAGATCTGAGGACAAAATTCTTACCATTGAGATTAAAAAAGGGTGGAAAGAA
GGCACCAAAATTACTTTTCCAAGAGAAGGAGATGAAACACCAAATAGTATTCCAGCAGACATTGTTTTTA
TCATTAAAGACAAAGATCATCCAAAATTTAAAAGGGATGGATCAAATATAATTTATACTGCTAAAATTAG
TTTACGAGAGGCATTGTGTGGCTGCTCAATTAATGTACCAACACTGGATGGAAGAAACATACCTATGTCA
GTAAATGATATTGTGAAACCCGGAATGAGGAGAAGAATTATTGGATATGGGCTGCCATTTCCAAAAAATC
CTGACCAACGTGGTGACCTTCTAATAGAATTTGAGGTGTCCTTCCCAGATACTATATCTTCTTCATCCAA
AGAAGTACTTAGGAAACATCTTCCTGCCTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203743 protein sequence
Red=Cloning site Green=Tags(s)

MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQFGEE
GLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMN
GYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNADGRSYRSEDKILTIEIKKGWKE
GTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLREALCGCSINVPTLDGRNIPMS
VNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007034
ORF Size 1011 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007034.5
RefSeq Size 2250 bp
RefSeq ORF 1014 bp
Locus ID 11080
UniProt ID Q9UDY4
Cytogenetics 1p31.1
Domains DnaJ, DnaJ_C
MW 37.8 kDa
Summary The protein encoded by this gene is a molecular chaperone, tumor suppressor, and member of the heat shock protein-40 family. The encoded protein binds the cell adhesion protein E-cadherin and targets it to the plasma membrane. This protein also binds incorrectly folded E-cadherin and targets it for endoplasmic reticulum-associated degradation. This gene is a strong tumor suppressor for colorectal carcinoma, and downregulation of it may serve as a good biomarker for predicting patient outcomes. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:DNAJB4 (NM_007034) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203743L1 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 4 (DNAJB4), Myc-DDK-tagged 10 ug
$757.00
RC203743L2 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 4 (DNAJB4), mGFP tagged 10 ug
$757.00
RC203743L3 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 4 (DNAJB4), Myc-DDK-tagged 10 ug
$757.00
RC203743L4 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily B, member 4 (DNAJB4), mGFP tagged 10 ug
$757.00
RG203743 DNAJB4 (tGFP-tagged) - Human DnaJ (Hsp40) homolog, subfamily B, member 4 (DNAJB4) 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC127340 DNAJB4 (untagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 4 (DNAJB4) 10 ug
$457.00
SC322522 DNAJB4 (untagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 4 (DNAJB4) 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.