C9ORF46 (PLGRKT) (NM_018465) Human Tagged ORF Clone

SKU
RC202315
PLGRKT (Myc-DDK-tagged)-Human chromosome 9 open reading frame 46 (C9orf46)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C9ORF46
Synonyms AD025; C9orf46; MDS030; Plg-R(KT); PLG-RKT
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202315 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGTTTATATTTTCAAAATCTATGAATGAAAGCATGAAAAATCAAAAGGAGTTCATGCTTATGAATG
CTCGACTTCAGCTGGAAAGGCAGCTCATCATGCAGAGTGAAATGAGGGAAAGACAAATGGCCATGCAGAT
TGCGTGGTCTCGGGAATTCCTCAAATATTTTGGAACTTTTTTTGGCCTTGCAGCCATCTCTTTAACAGCT
GGAGCGATTAAAAAAAAGAAGCCAGCCTTCCTGGTCCCGATTGTTCCATTAAGCTTTATCCTCACCTACC
AGTATGACTTGGGCTATGGAACCCTTTTAGAAAGAATGAAAGGTGAAGCTGAGGACATACTGGAAACAGA
AAAGAGTAAATTGCAGCTGCCAAGAGGAATGATCACTTTTGAAAGCATTGAAAAAGCCAGAAAGGAACAG
AGTAGATTCTTCATAGACAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202315 protein sequence
Red=Cloning site Green=Tags(s)

MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTFFGLAAISLTA
GAIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQ
SRFFIDK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018465
ORF Size 441 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018465.4
RefSeq Size 1020 bp
RefSeq ORF 444 bp
Locus ID 55848
UniProt ID Q9HBL7
Cytogenetics 9p24.1
Protein Families Transmembrane
MW 17.2 kDa
Summary Receptor for plasminogen. Regulates urokinase plasminogen activator-dependent and stimulates tissue-type plasminogen activator-dependent cell surface plasminogen activation. Proposed to be part of a local catecholaminergic cell plasminogen activation system that regulates neuroendocrine prohormone processing. Involved in regulation of inflammatory response; regulates monocyte chemotactic migration and matrix metalloproteinase activation, such as of MMP2 and MMP9.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C9ORF46 (PLGRKT) (NM_018465) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202315L1 Lenti ORF clone of Human chromosome 9 open reading frame 46 (C9orf46), Myc-DDK-tagged 10 ug
$450.00
RC202315L2 Lenti ORF clone of Human chromosome 9 open reading frame 46 (C9orf46), mGFP tagged 10 ug
$450.00
RC202315L3 Lenti ORF clone of Human chromosome 9 open reading frame 46 (C9orf46), Myc-DDK-tagged 10 ug
$450.00
RC202315L4 Lenti ORF clone of Human chromosome 9 open reading frame 46 (C9orf46), mGFP tagged 10 ug
$450.00
RG202315 PLGRKT (tGFP-tagged) - Human chromosome 9 open reading frame 46 (C9orf46) 10 ug
$350.00
SC113479 PLGRKT (untagged)-Human chromosome 9 open reading frame 46 (C9orf46) 10 ug
$150.00
SC322249 PLGRKT (untagged)-Human chromosome 9 open reading frame 46 (C9orf46) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.