C9ORF46 (PLGRKT) Rabbit Polyclonal Antibody

SKU TA331041

Rabbit polyclonal Anti-C9orf46 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C9orf46 antibody: synthetic peptide directed towards the middle region of human C9orf46. Synthetic peptide located within the following region: AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 17 kDa
• Gene Name: plasminogen receptor with a C-terminal lysine
• Database Link:
  NP_060935
  Q9HBL7
• Background: The exact function of C9orf46 remains unknown.
• Synonyms: AD025; C9orf46; MDS030; Plg-R(KT); PLG-RKT
• Note: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 92%; Rabbit: 85%; Bovine: 77%

Reference Data

• Protein Families: Transmembrane