OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COX7A1 (NM_001864) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC201154
COX7A1 (Myc-DDK-tagged)-Human cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) (COX7A1), nuclear gene encoding mitochondrial protein
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA358875 COX7A1 Antibody - N-terminal region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "COX7A1 or NM_001864"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol COX7A1
Synonyms COX7A; COX7AH; COX7AM
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201154 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGCCCTTCGGGTGTCCCAGGCGCTGATCCGCTCCTTCAGCTCCACCGCCCGGAACCGCTTTCAGA
ACCGAGTGCGCGAGAAACAGAAGCTCTTCCAGGAGGACAATGACATCCCGTTGTACCTGAAGGGCGGCAT
CGTTGACAACATCCTGTACCGAGTGACAATGACGCTGTGTCTGGGCGGCACTGTCTACAGCTTGTACTCC
CTTGGCTGGGCCTCCTTCCCCAGGAAT

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC201154 protein sequence
Red=Cloning site Green=Tags(s)

MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYS
LGWASFPRN

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene | Plasmid Map
ACCN NM_001864
ORF Size 237 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001864.4
RefSeq Size 783 bp
RefSeq ORF 240 bp
Locus ID 1346
UniProt ID P24310
Cytogenetics 19q13.12
Protein Families Transmembrane
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Oxidative phosphorylation, Parkinson's disease
MW 9.1 kDa
Summary Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (muscle isoform) of subunit VIIa and the polypeptide 1 is present only in muscle tissues. Other polypeptides of subunit VIIa are present in both muscle and nonmuscle tissues, and are encoded by different genes. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001864" in other vectors (4)
SKU Description Size Price
RC201154L3 Lenti ORF clone of Human cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) (COX7A1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC201154L4 Lenti ORF clone of Human cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) (COX7A1), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
RG201154 COX7A1 (tGFP-tagged) - Human cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) (COX7A1), nuclear gene encoding mitochondrial protein 10 ug
$489.00
SC118989 COX7A1 (untagged)-Human cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) (COX7A1), nuclear gene encoding mitochondrial protein 10 ug
$150.00

Plasmid Map for RC201154

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC201154
Circular map for RC201154

file-alt Citations

Two independent respiratory chains adapt OXPHOS performance to glycolytic switch
Fernández-Vizarra, López-Calcerrada, Sierra-Magro et al
Cell Metab (2022) 34 (11), 1792-1808.e6 DOI: 10.1016/j.cmet.2022.09.005
Cited by 96
AI Summary: In this study, OriGene products—including COX7A2L-Myc-DDK (Cat# RC202697), COX7A1-Myc-DDK (Cat# RC201154), COX7A2-Myc-DDK (Cat# RC215973), and pCMV6-A-Entry-Hygro (Cat# PS100024)—were used to investigate the roles of COX7A subunit isoforms in organizing mitochondrial respiratory chain structures and adapting oxidative phosphorylation to metabolic changes.
Snippet: pSp-CAS9(BB)-2A-GFP (PX458) Ran et al., 2013 Addgene# 48138 COX7A2L- Myc-DDK Origene Cat#RC202697 COX7A1- Myc-DDK Origene Cat#RC201154 COX7A2- Myc-DDK Origene Cat#RC215973 pCMV6-A-Entry-Hygro Origene Cat# PS100024 COX7A2L-Myc-DDK in pCMV6-A-Entry-Hygro Lobo-Jarne et al., 2018 N/A
Human COX7A2L Regulates Complex III Biogenesis and Promotes Supercomplex Organization Remodeling without Affecting Mitochondrial Bioenergetics
Lobo-Jarne, Nývltová, Pérez-Pérez et al
Cell Rep (2018) 25 (7), 1786-1799.e4 DOI: 10.1016/j.celrep.2018.10.058
AI Summary: In this study, OriGene's HSP70 (HSPA6) antibody (Cat# TA501950) was used to detect HSP70 protein levels, aiding in the characterization of mitochondrial protein expression in COX7A2L-knockout cells.
Snippet: HSP70 (HSPA6) Origene Cat# TA501950 RRID: AB_11124627 NDUFA9 Abcam Cat# ab14713 RRID: AB_301431 NDUFS1 Abcam Cat# ab52690 RRID: AB_2151096
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products