COX7A1 (NM_001864) Human Tagged ORF Clone
SKU
RG201154
COX7A1 (tGFP-tagged) - Human cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) (COX7A1), nuclear gene encoding mitochondrial protein
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | COX7A1 |
Synonyms | COX7A; COX7AH; COX7AM |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RG201154 representing NM_001864
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCAGGCCCTTCGGGTGTCCCAGGCGCTGATCCGCTCCTTCAGCTCCACCGCCCGGAACCGCTTTCAGA ACCGAGTGCGCGAGAAACAGAAGCTCTTCCAGGAGGACAATGACATCCCGTTGTACCTGAAGGGCGGCAT CGTTGACAACATCCTGTACCGAGTGACAATGACGCTGTGTCTGGGCGGCACTGTCTACAGCTTGTACTCC CTTGGCTGGGCCTCCTTCCCCAGGAAT AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201154 representing NM_001864
Red=Cloning site Green=Tags(s) MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYS LGWASFPRN SGPTRTRRLE - GFP Tag - V |
Restriction Sites |
SgfI-RsrII Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001864 |
ORF Size | 237 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_001864.4 |
RefSeq Size | 783 bp |
RefSeq ORF | 240 bp |
Locus ID | 1346 |
UniProt ID | P24310 |
Cytogenetics | 19q13.12 |
Protein Families | Transmembrane |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Oxidative phosphorylation, Parkinson's disease |
Summary | Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (muscle isoform) of subunit VIIa and the polypeptide 1 is present only in muscle tissues. Other polypeptides of subunit VIIa are present in both muscle and nonmuscle tissues, and are encoded by different genes. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC201154 | COX7A1 (Myc-DDK-tagged)-Human cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) (COX7A1), nuclear gene encoding mitochondrial protein | 10 ug |
$150.00
|
|
RC201154L3 | Lenti ORF clone of Human cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) (COX7A1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC201154L4 | Lenti ORF clone of Human cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) (COX7A1), nuclear gene encoding mitochondrial protein, mGFP tagged | 10 ug |
$450.00
|
|
SC118989 | COX7A1 (untagged)-Human cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) (COX7A1), nuclear gene encoding mitochondrial protein | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.