ESE1 (ELF3) (NM_004433) Human Tagged ORF Clone

SKU
RC200631
ELF3 (Myc-DDK-tagged)-Human E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$457.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ESE1
Synonyms EPR-1; ERT; ESE-1; ESX
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200631 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCAACCTGTGAGATTAGCAACATTTTTAGCAACTACTTCAGTGCGATGTACAGCTCGGAGGACT
CCACCCTGGCCTCTGTTCCCCCTGCTGCCACCTTTGGGGCCGATGACTTGGTACTGACCCTGAGCAACCC
CCAGATGTCATTGGAGGGTACAGAGAAGGCCAGCTGGTTGGGGGAACAGCCCCAGTTCTGGTCGAAGACG
CAGGTTCTGGACTGGATCAGCTACCAAGTGGAGAAGAACAAGTACGACGCAAGCGCCATTGACTTCTCAC
GATGTGACATGGATGGCGCCACCCTCTGCAATTGTGCCCTTGAGGAGCTGCGTCTGGTCTTTGGGCCTCT
GGGGGACCAACTCCATGCCCAGCTGCGAGACCTCACTTCCAGCTCTTCTGATGAGCTCAGTTGGATCATT
GAGCTGCTGGAGAAGGATGGCATGGCCTTCCAGGAGGCCCTAGACCCAGGGCCCTTTGACCAGGGCAGCC
CCTTTGCCCAGGAGCTGCTGGACGACGGTCAGCAAGCCAGCCCCTACCACCCCGGCAGCTGTGGCGCAGG
AGCCCCCTCCCCTGGCAGCTCTGACGTCTCCACCGCAGGGACTGGTGCTTCTCGGAGCTCCCACTCCTCA
GACTCCGGTGGAAGTGACGTGGACCTGGATCCCACTGATGGCAAGCTCTTCCCCAGCGATGGTTTTCGTG
ACTGCAAGAAGGGGGATCCCAAGCACGGGAAGCGGAAACGAGGCCGGCCCCGAAAGCTGAGCAAAGAGTA
CTGGGACTGTCTCGAGGGCAAGAAGAGCAAGCACGCGCCCAGAGGCACCCACCTGTGGGAGTTCATCCGG
GACATCCTCATCCACCCGGAGCTCAACGAGGGCCTCATGAAGTGGGAGAATCGGCATGAAGGCGTCTTCA
AGTTCCTGCGCTCCGAGGCTGTGGCCCAACTATGGGGCCAAAAGAAAAAGAACAGCAACATGACCTACGA
GAAGCTGAGCCGGGCCATGAGGTACTACTACAAACGGGAGATCCTGGAACGGGTGGATGGCCGGCGACTC
GTCTACAAGTTTGGCAAAAACTCAAGCGGCTGGAAGGAGGAAGAGGTTCTCCAGAGTCGGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200631 protein sequence
Red=Cloning site Green=Tags(s)

MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKT
QVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWII
ELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSS
DSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR
DILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRL
VYKFGKNSSGWKEEEVLQSRN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004433
ORF Size 1113 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004433.5
RefSeq Size 3149 bp
RefSeq ORF 1116 bp
Locus ID 1999
UniProt ID P78545
Cytogenetics 1q32.1
Domains AT_hook, ETS, SAM_PNT
Protein Families Transcription Factors
MW 41.5 kDa
Summary Transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter. Also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. Represses KRT4 promoter activity. Involved in mediating vascular inflammation. May play an important role in epithelial cell differentiation and tumorigenesis. May be a critical downstream effector of the ERBB2 signaling pathway. May be associated with mammary gland development and involution. Plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ESE1 (ELF3) (NM_004433) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200631L1 Lenti ORF clone of Human E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC200631L2 Lenti ORF clone of Human E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1, mGFP tagged 10 ug
$757.00
RC200631L3 Lenti ORF clone of Human E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC200631L4 Lenti ORF clone of Human E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1, mGFP tagged 10 ug
$757.00
RG200631 ELF3 (tGFP-tagged) - Human E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1 10 ug
$489.00 MSRP $657.00 MSRP $657.00
SC117348 ELF3 (untagged)-Human E74-like factor 3 (ets domain transcription factor, epithelial-specific ) (ELF3), transcript variant 1 10 ug
$457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.