HAND1 (NM_004821) Human Tagged ORF Clone

SKU
RC200513
HAND1 (Myc-DDK-tagged)-Human heart and neural crest derivatives expressed 1 (HAND1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HAND1
Synonyms bHLHa27; eHand; Hxt; Thing1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200513 representing NM_004821
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCTCGTGGGCAGCTACGCACACCATCACCACCATCACCACCCGCACCCTGCGCACCCCATGCTCC
ACGAACCCTTCCTCTTCGGTCCGGCCTCGCGCTGTCATCAGGAAAGGCCCTACTTCCAGAGCTGGCTGCT
GAGCCCGGCTGACGCTGCCCCGGACTTCCCTGCGGGCGGGCCGCCGCCCGCGGCCGCTGCAGCCGCCACC
GCCTATGGTCCTGACGCCAGGCCTGGGCAGAGCCCCGGGCGGCTGGAGGCGCTTGGCGGCCGTCTTGGCC
GGCGGAAAGGCTCAGGACCCAAGAAGGAGCGGAGACGCACTGAGAGCATTAACAGCGCATTCGCGGAGTT
GCGCGAGTGCATCCCCAACGTGCCGGCCGACACCAAGCTCTCCAAGATCAAGACTCTGCGCCTAGCCACC
AGCTACATCGCCTACCTGATGGACGTGCTGGCCAAGGATGCACAGTCTGGCGATCCCGAGGCCTTCAAGG
CTGAACTCAAGAAGGCGGATGGCGGCCGTGAGAGCAAGCGGAAAAGGGAGCTGCAGCAGCACGAAGGTTT
TCCTCCTGCCCTGGGCCCAGTCGAGAAGAGGATTAAAGGACGCACCGGCTGGCCGCAGCAAGTCTGGGCG
CTGGAGTTAAACCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200513 representing NM_004821
Red=Cloning site Green=Tags(s)

MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAAT
AYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLAT
SYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWA
LELNQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004821
ORF Size 645 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004821.3
RefSeq Size 1750 bp
RefSeq ORF 648 bp
Locus ID 9421
UniProt ID O96004
Cytogenetics 5q33.2
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
MW 23.4 kDa
Summary The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, it has been suggested that this transcription factor may be required for early trophoblast differentiation. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:HAND1 (NM_004821) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200513L1 Lenti ORF clone of Human heart and neural crest derivatives expressed 1 (HAND1), Myc-DDK-tagged 10 ug
$600.00
RC200513L2 Lenti ORF clone of Human heart and neural crest derivatives expressed 1 (HAND1), mGFP tagged 10 ug
$600.00
RC200513L3 Lenti ORF clone of Human heart and neural crest derivatives expressed 1 (HAND1), Myc-DDK-tagged 10 ug
$600.00
RC200513L4 Lenti ORF clone of Human heart and neural crest derivatives expressed 1 (HAND1), mGFP tagged 10 ug
$600.00
RG200513 HAND1 (tGFP-tagged) - Human heart and neural crest derivatives expressed 1 (HAND1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC122690 HAND1 (untagged)-Human heart and neural crest derivatives expressed 1 (HAND1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.