SKA3 (NM_001166017) Human Recombinant Protein

SKU
TP328314
Recombinant protein of human spindle and kinetochore associated complex subunit 3 (SKA3), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC228314 representing NM_001166017
Red=Cloning site Green=Tags(s)

MDPIRSFCGKLRSLASTLDCETARLQRALDGEESDFEDYPMRILYDLHSEVQTLKDDVNILLDKARLENQ
EGIDFIKATKVLMEKNSMDIMKIREYFQKYGYSPRVKKNSVHEQEAINSDPELSNCENFQKTDVKDDLSD
PPVASSCISEKSPRSPQLSDFGLERYIVSQVLPNPPQAVNNYKEEPVIVTPPTKQSLVKVLKTPKCALKM
DDFECVTPKLEHFGISEYTMCLNEDYTMGLKNARNNKSEEAIDTESRLNDNVFATPSPIIQQLEKSDAEY
TNSPLVPTFCTPGLKIPSTKNSIALVSTNYPLSKTNSSSNDLEVEDRTSLVLNSDTCFENLTDPSSPTIS
SYENLLRTPTPPEVTKIPEDILQKFQWIYPTQKLNKMR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 43.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001159489
Locus ID 221150
UniProt ID Q8IX90
Cytogenetics 13q12.11
RefSeq ORF 1164
Synonyms C13orf3; RAMA1
Summary This gene encodes a component of the spindle and kinetochore-associated protein complex that regulates microtubule attachment to the kinetochores during mitosis. The encoded protein localizes to the outer kinetechore and may be required for normal chromosome segregation and cell division. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:SKA3 (NM_001166017) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH322931 SKA3 MS Standard C13 and N15-labeled recombinant protein (NP_659498) 10 ug
$3,255.00
LC408058 SKA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431342 SKA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408058 Transient overexpression lysate of spindle and kinetochore associated complex subunit 3 (SKA3), transcript variant 1 100 ug
$436.00
LY431342 Transient overexpression lysate of spindle and kinetochore associated complex subunit 3 (SKA3), transcript variant 2 100 ug
$436.00
TP322931 Recombinant protein of human chromosome 13 open reading frame 3 (C13orf3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.