SKA3 (NM_145061) Human Mass Spec Standard

SKU
PH322931
SKA3 MS Standard C13 and N15-labeled recombinant protein (NP_659498)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC222931]
Predicted MW 46.2 kDa
Protein Sequence
Protein Sequence
>RC222931 representing NM_145061
Red=Cloning site Green=Tags(s)

MDPIRSFCGKLRSLASTLDCETARLQRALDGEESDFEDYPMRILYDLHSEVQTLKDDVNILLDKARLENQ
EGIDFIKATKVLMEKNSMDIMKIREYFQKYGYSPRVKKNSVHEQEAINSDPELSNCENFQKTDVKDDLSD
PPVASSCISEKSPRSPQLSDFGLERYIVSQVLPNPPQAVNNYKEEPVIVTPPTKQSLVKVLKTPKCALKM
DDFECVTPKLEHFGISEYTMCLNEDYTMGLKNARNNKSEEAIDTESRLNDNVFATPSPIIQQLEKSDAEY
TNSPLVPTFCTPGLKIPSTKNSIALVSTNYPLSKTNSSSNDLEVEDRTSLVLNSDTCFENLTDPSSPTIS
SYENLLRTPTPPEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_659498
RefSeq Size 2907
RefSeq ORF 1236
Synonyms C13orf3; RAMA1
Locus ID 221150
UniProt ID Q8IX90
Cytogenetics 13q12.11
Summary This gene encodes a component of the spindle and kinetochore-associated protein complex that regulates microtubule attachment to the kinetochores during mitosis. The encoded protein localizes to the outer kinetechore and may be required for normal chromosome segregation and cell division. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:SKA3 (NM_145061) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408058 SKA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431342 SKA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408058 Transient overexpression lysate of spindle and kinetochore associated complex subunit 3 (SKA3), transcript variant 1 100 ug
$436.00
LY431342 Transient overexpression lysate of spindle and kinetochore associated complex subunit 3 (SKA3), transcript variant 2 100 ug
$436.00
TP322931 Recombinant protein of human chromosome 13 open reading frame 3 (C13orf3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP328314 Recombinant protein of human spindle and kinetochore associated complex subunit 3 (SKA3), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.