ZNF447 (ZSCAN18) (NM_001145543) Human Recombinant Protein
SKU
TP327637
Recombinant protein of human zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 4, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC227637 protein sequence
Red=Cloning site Green=Tags(s) MLPLEKAFASPRSSPAPPDLPTPGSAAGVQQEEPETIPERTPADLEFSRLRFREFVYQEAAGPHQTLARL HELCRQWLMPEARSKEQMLELLVLEQFLGILPDKVRPWVVAQYPESCKKAASLVEGLADVLEEPGMLLGS PAGSSSILSDGVYERHMDPLLLPGELASPSQALGAGEIPAPSETPWLSPDPLFLEQRRVREAKTEEDGPA NTEQKLKSFPEDPQHLGEWGHLDPAEENLKSYRKLLLWGYQLSQPDAASRLDTEELRLVERDPQGSSLPE GGRRQESAGCACEEAAPAGVLPELPTEAPPGDALADPPSGTTEEEEEQPGKAPDPQDPQDAESDSATGSQ RQSVIQQPAPDRGTAKLGTKRPHPEDGDEQSLEGVSSSGDSAGLEAGQGPGADEPGLSRGKPYACGECGE AFAWLSHLMEHHSSHGGRKRYACQGCWKTFHFSLALAEHQKTHEKEKSYALGGARGPQPSTREAQAGARA GGPPESVEGEAPPAPPEAQR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001139015 |
Locus ID | 65982 |
UniProt ID | Q8TBC5 |
Cytogenetics | 19q13.43 |
RefSeq Size | 2716 |
RefSeq ORF | 1530 |
Synonyms | ZNF447 |
Summary | May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303390 | ZSCAN18 MS Standard C13 and N15-labeled recombinant protein (NP_076415) | 10 ug |
$3,255.00
|
|
PH327637 | ZSCAN18 MS Standard C13 and N15-labeled recombinant protein (NP_001139015) | 10 ug |
$3,255.00
|
|
LC402961 | ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428933 | ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC428934 | ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402961 | Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 3 | 100 ug |
$436.00
|
|
LY428933 | Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 1 | 100 ug |
$436.00
|
|
LY428934 | Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 4 | 100 ug |
$436.00
|
|
TP303390 | Purified recombinant protein of Homo sapiens zinc finger and SCAN domain containing 18 (ZSCAN18), 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.