ZNF447 (ZSCAN18) (NM_023926) Human Recombinant Protein

SKU
TP303390
Purified recombinant protein of Homo sapiens zinc finger and SCAN domain containing 18 (ZSCAN18), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203390 protein sequence
Red=Cloning site Green=Tags(s)

MLPLEKAFASPRSSPAPPDLPTPGSAAGVQQEEPETIPERTPADLEFSRLRFREFVYQEAAGPHQTLARL
HELCRQWLMPEARSKEQMLELLVLEQFLGILPDKVRPWVVAQYPESCKKAASLVEGLADVLEEPGMLLGS
PAGSSSILSDGVYERHMDPLLLPGELASPSQALGAGEIPAPSETPWLSPDPLFLEQRRVREAKTEEDGPA
NTEQKLKSFPEDPQHLGEWGHLDPAEENLKSYRKLLLWGYQLSQPDAASRLDTEELRLVERDPQGSSLPE
GGRRQESAGCACEEAAPAGVLPELPTEAPPGDALADPPSGTTEEEEEQPGKAPDPQDPQDAESDSATGSQ
RQSVIQQPAPDRGTAKLGTKRPHPEDGDEQSLEGVSSSGDSAGLEAGQGPGADEPGLSRGKPYACGECGE
AFAWLSHLMEHHSSHGGRKRYACQGCWKTFHFSLALAEHQKTHEKEKSYALGGARGPQPSTREAQAGARA
GGPPESVEGEAPPAPPEAQR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_076415
Locus ID 65982
UniProt ID Q8TBC5
Cytogenetics 19q13.43
RefSeq Size 2960
RefSeq ORF 1530
Synonyms ZNF447
Summary May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZNF447 (ZSCAN18) (NM_023926) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303390 ZSCAN18 MS Standard C13 and N15-labeled recombinant protein (NP_076415) 10 ug
$3,255.00
PH327637 ZSCAN18 MS Standard C13 and N15-labeled recombinant protein (NP_001139015) 10 ug
$3,255.00
LC402961 ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428933 ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428934 ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402961 Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 3 100 ug
$436.00
LY428933 Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 1 100 ug
$436.00
LY428934 Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 4 100 ug
$436.00
TP327637 Recombinant protein of human zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 4, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.