ZNF447 (ZSCAN18) (NM_001145543) Human Mass Spec Standard

SKU
PH327637
ZSCAN18 MS Standard C13 and N15-labeled recombinant protein (NP_001139015)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227637]
Predicted MW 54.9 kDa
Protein Sequence
Protein Sequence
>RC227637 protein sequence
Red=Cloning site Green=Tags(s)

MLPLEKAFASPRSSPAPPDLPTPGSAAGVQQEEPETIPERTPADLEFSRLRFREFVYQEAAGPHQTLARL
HELCRQWLMPEARSKEQMLELLVLEQFLGILPDKVRPWVVAQYPESCKKAASLVEGLADVLEEPGMLLGS
PAGSSSILSDGVYERHMDPLLLPGELASPSQALGAGEIPAPSETPWLSPDPLFLEQRRVREAKTEEDGPA
NTEQKLKSFPEDPQHLGEWGHLDPAEENLKSYRKLLLWGYQLSQPDAASRLDTEELRLVERDPQGSSLPE
GGRRQESAGCACEEAAPAGVLPELPTEAPPGDALADPPSGTTEEEEEQPGKAPDPQDPQDAESDSATGSQ
RQSVIQQPAPDRGTAKLGTKRPHPEDGDEQSLEGVSSSGDSAGLEAGQGPGADEPGLSRGKPYACGECGE
AFAWLSHLMEHHSSHGGRKRYACQGCWKTFHFSLALAEHQKTHEKEKSYALGGARGPQPSTREAQAGARA
GGPPESVEGEAPPAPPEAQR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001139015
RefSeq Size 2716
RefSeq ORF 1530
Synonyms ZNF447
Locus ID 65982
UniProt ID Q8TBC5
Cytogenetics 19q13.43
Summary May be involved in transcriptional regulation.[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZNF447 (ZSCAN18) (NM_001145543) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303390 ZSCAN18 MS Standard C13 and N15-labeled recombinant protein (NP_076415) 10 ug
$3,255.00
LC402961 ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428933 ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428934 ZSCAN18 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402961 Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 3 100 ug
$436.00
LY428933 Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 1 100 ug
$436.00
LY428934 Transient overexpression lysate of zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 4 100 ug
$436.00
TP303390 Purified recombinant protein of Homo sapiens zinc finger and SCAN domain containing 18 (ZSCAN18), 20 µg 20 ug
$737.00
TP327637 Recombinant protein of human zinc finger and SCAN domain containing 18 (ZSCAN18), transcript variant 4, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.