LRRC8A (NM_001127245) Human Recombinant Protein

SKU
TP326181
Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226181 protein sequence
Red=Cloning site Green=Tags(s)

MIPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDKMICLPCKWVTKDSCNDSFR
GWAAPGPEPTYPNSTILPTPDTGPTGIKYDLDRHQYNYVDAVCYENRLHWFAKYFPYLVLLHTLIFLACS
NFWFKFPRTSSKLEHFVSILLKCFDSPWTTRALSETVVEESDPKPAFSKMNGSMDKKSSTVSEDVEATVP
MLQRTKSRIEQGIVDRSETGVLDKKEGEQAKALFEKVKKFRTHVEEGDIVYRLYMRQTIIKVIKFILIIC
YTVYYVHNIKFDVDCTVDIESLTGYRTYRCAHPLATLFKILASFYISLVIFYGLICMYTLWWMLRRSLKK
YSFESIREESSYSDIPDVKNDFAFMLHLIDQYDPLYSKRFAVFLSEVSENKLRQLNLNNEWTLDKLRQRL
TKNAQDKLELHLFMLSGIPDTVFDLVELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTAAKIEAPALAF
LRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRYIVIDGLRELKRLKVLRLKSNLSKLPQ
VVTDVGVHLQKLSINNEGTKLIVLNSLKKMANLTELELIRCDLERIPHSIFSLHNLQEIDLKDNNLKTIE
EIISFQHLHRLTCLKLWYNHIAYIPIQIGNLTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFL
PADIGLLQNLQNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLP
VELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 94 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001120717
Locus ID 56262
UniProt ID Q8IWT6
Cytogenetics 9q34.11
RefSeq Size 4261
RefSeq ORF 2430
Synonyms AGM5; HsLRRC8A; LRRC8; SWELL1
Summary This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:LRRC8A (NM_001127245) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308632 LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_062540) 10 ug
$3,255.00
PH326180 LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_001120716) 10 ug
$3,255.00
PH326181 LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_001120717) 10 ug
$3,255.00
LC412721 LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426737 LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426738 LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412721 Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2 100 ug
$436.00
LY426737 Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 1 100 ug
$665.00
LY426738 Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 3 100 ug
$665.00
TP308632 Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2, 20 µg 20 ug
$737.00
TP326180 Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.