LRRC8A (NM_001127244) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC226180] |
Predicted MW | 94.2 kDa |
Protein Sequence |
Protein Sequence
>RC226180 protein sequence
Red=Cloning site Green=Tags(s) MIPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDKMICLPCKWVTKDSCNDSFR GWAAPGPEPTYPNSTILPTPDTGPTGIKYDLDRHQYNYVDAVCYENRLHWFAKYFPYLVLLHTLIFLACS NFWFKFPRTSSKLEHFVSILLKCFDSPWTTRALSETVVEESDPKPAFSKMNGSMDKKSSTVSEDVEATVP MLQRTKSRIEQGIVDRSETGVLDKKEGEQAKALFEKVKKFRTHVEEGDIVYRLYMRQTIIKVIKFILIIC YTVYYVHNIKFDVDCTVDIESLTGYRTYRCAHPLATLFKILASFYISLVIFYGLICMYTLWWMLRRSLKK YSFESIREESSYSDIPDVKNDFAFMLHLIDQYDPLYSKRFAVFLSEVSENKLRQLNLNNEWTLDKLRQRL TKNAQDKLELHLFMLSGIPDTVFDLVELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTAAKIEAPALAF LRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRYIVIDGLRELKRLKVLRLKSNLSKLPQ VVTDVGVHLQKLSINNEGTKLIVLNSLKKMANLTELELIRCDLERIPHSIFSLHNLQEIDLKDNNLKTIE EIISFQHLHRLTCLKLWYNHIAYIPIQIGNLTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFL PADIGLLQNLQNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLP VELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001120716 |
RefSeq Size | 4637 |
RefSeq ORF | 2430 |
Synonyms | AGM5; HsLRRC8A; LRRC8; SWELL1 |
Locus ID | 56262 |
UniProt ID | Q8IWT6 |
Cytogenetics | 9q34.11 |
Summary | This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH308632 | LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_062540) | 10 ug |
$3,255.00
|
|
PH326181 | LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_001120717) | 10 ug |
$3,255.00
|
|
LC412721 | LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426737 | LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC426738 | LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY412721 | Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2 | 100 ug |
$436.00
|
|
LY426737 | Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 1 | 100 ug |
$665.00
|
|
LY426738 | Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 3 | 100 ug |
$665.00
|
|
TP308632 | Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP326180 | Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP326181 | Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.