LRRC8A (NM_001127245) Human Mass Spec Standard

SKU
PH326181
LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_001120717)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226181]
Predicted MW 94.2 kDa
Protein Sequence
Protein Sequence
>RC226181 protein sequence
Red=Cloning site Green=Tags(s)

MIPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDKMICLPCKWVTKDSCNDSFR
GWAAPGPEPTYPNSTILPTPDTGPTGIKYDLDRHQYNYVDAVCYENRLHWFAKYFPYLVLLHTLIFLACS
NFWFKFPRTSSKLEHFVSILLKCFDSPWTTRALSETVVEESDPKPAFSKMNGSMDKKSSTVSEDVEATVP
MLQRTKSRIEQGIVDRSETGVLDKKEGEQAKALFEKVKKFRTHVEEGDIVYRLYMRQTIIKVIKFILIIC
YTVYYVHNIKFDVDCTVDIESLTGYRTYRCAHPLATLFKILASFYISLVIFYGLICMYTLWWMLRRSLKK
YSFESIREESSYSDIPDVKNDFAFMLHLIDQYDPLYSKRFAVFLSEVSENKLRQLNLNNEWTLDKLRQRL
TKNAQDKLELHLFMLSGIPDTVFDLVELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTAAKIEAPALAF
LRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRYIVIDGLRELKRLKVLRLKSNLSKLPQ
VVTDVGVHLQKLSINNEGTKLIVLNSLKKMANLTELELIRCDLERIPHSIFSLHNLQEIDLKDNNLKTIE
EIISFQHLHRLTCLKLWYNHIAYIPIQIGNLTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFL
PADIGLLQNLQNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLP
VELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001120717
RefSeq Size 4261
RefSeq ORF 2430
Synonyms AGM5; HsLRRC8A; LRRC8; SWELL1
Locus ID 56262
UniProt ID Q8IWT6
Cytogenetics 9q34.11
Summary This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:LRRC8A (NM_001127245) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH308632 LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_062540) 10 ug
$3,255.00
PH326180 LRRC8A MS Standard C13 and N15-labeled recombinant protein (NP_001120716) 10 ug
$3,255.00
LC412721 LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426737 LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426738 LRRC8A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412721 Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2 100 ug
$436.00
LY426737 Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 1 100 ug
$665.00
LY426738 Transient overexpression lysate of leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 3 100 ug
$665.00
TP308632 Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 2, 20 µg 20 ug
$737.00
TP326180 Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 1, 20 µg 20 ug
$737.00
TP326181 Recombinant protein of human leucine rich repeat containing 8 family, member A (LRRC8A), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.