CAB39 (NM_001130850) Human Recombinant Protein

SKU
TP325505
Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225505 protein sequence
Red=Cloning site Green=Tags(s)

MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQL
AQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIA
LNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRF
FSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKV
FVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001124322
Locus ID 51719
UniProt ID Q9Y376
Cytogenetics 2q37.1
RefSeq Size 3712
RefSeq ORF 1023
Synonyms CGI-66; MO25
Summary Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1.[UniProtKB/Swiss-Prot Function]
Protein Pathways mTOR signaling pathway
Write Your Own Review
You're reviewing:CAB39 (NM_001130850) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304563 CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_057373) 10 ug
$3,255.00
PH325504 CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_001124321) 10 ug
$3,255.00
PH325505 CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_001124322) 10 ug
$3,255.00
LC402536 CAB39 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427286 CAB39 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427287 CAB39 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402536 Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 1 100 ug
$436.00
LY427286 Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 2 100 ug
$436.00
LY427287 Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 3 100 ug
$436.00
TP304563 Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325504 Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.