CAB39 (NM_016289) Human Recombinant Protein
SKU
TP304563
Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC204563 protein sequence
Red=Cloning site Green=Tags(s) MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQL AQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIA LNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRF FSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKV FVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_057373 |
Locus ID | 51719 |
UniProt ID | Q9Y376 |
Cytogenetics | 2q37.1 |
RefSeq Size | 3846 |
RefSeq ORF | 1023 |
Synonyms | CGI-66; MO25 |
Summary | Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | mTOR signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH304563 | CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_057373) | 10 ug |
$3,255.00
|
|
PH325504 | CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_001124321) | 10 ug |
$3,255.00
|
|
PH325505 | CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_001124322) | 10 ug |
$3,255.00
|
|
LC402536 | CAB39 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427286 | CAB39 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427287 | CAB39 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402536 | Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 1 | 100 ug |
$436.00
|
|
LY427286 | Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 2 | 100 ug |
$436.00
|
|
LY427287 | Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 3 | 100 ug |
$436.00
|
|
TP325504 | Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP325505 | Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.