CLEC2A (NM_001130711) Human Recombinant Protein

SKU TP325182

Purified recombinant protein of Homo sapiens C-type lectin domain family 2, member A (CLEC2A), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC225182 representing NM_001130711; Red=Cloning site Green=Tags(s); ; MINPELRDGRADGFIHRIVPKLIQNWKIGLMCFLSIIITTVCIIMIATWSKHAKPVACSGDWLGVRDKCF; YFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTFNGWFEI; IGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001124183
• Locus ID: 387836
• UniProt ID: Q6UVW9
• Cytogenetics: 12p13.31
• RefSeq ORF: 522
• Synonyms: INPE5792; KACL; PILAR; UNQ5792
• Summary: CLEC2A belongs to the CLEC2 family of activation-induced, natural killer gene complex-encoded C-type lectin-like receptors (Spreu et al., 2007 [PubMed 18046548]).[supplied by OMIM, May 2008]