CLEC2A (NM_001130711) Human Tagged ORF Clone

SKU
RC225182
CLEC2A (Myc-DDK-tagged)-Human C-type lectin domain family 2, member A (CLEC2A)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CLEC2A
Synonyms INPE5792; KACL; PILAR; UNQ5792
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC225182 representing NM_001130711
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTAATCCAGAGCTGCGGGATGGCAGAGCTGATGGCTTCATACATCGGATAGTTCCCAAGTTGATAC
AAAACTGGAAGATTGGCCTTATGTGCTTCCTGAGTATTATTATTACTACAGTTTGCATTATTATGATAGC
CACATGGTCCAAGCATGCTAAACCTGTGGCATGTTCAGGGGACTGGCTTGGAGTGAGAGATAAGTGTTTC
TATTTTTCTGATGATACCAGAAATTGGACAGCCAGTAAAATATTTTGTAGTTTGCAGAAAGCAGAACTTG
CTCAGATTGATACACAAGAAGACATGGAATTTTTGAAGAGGTACGCAGGAACTGATATGCACTGGATTGG
ACTAAGCAGGAAACAAGGAGATTCTTGGAAATGGACAAATGGCACCACATTCAATGGTTGGTTTGAAATT
ATAGGGAACGGATCCTTTGCTTTCTTGAGTGCTGATGGAGTCCATAGTTCCAGAGGATTTATTGATATCA
AGTGGATTTGCAGCAAACCTAAATATTTTTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC225182 representing NM_001130711
Red=Cloning site Green=Tags(s)

MINPELRDGRADGFIHRIVPKLIQNWKIGLMCFLSIIITTVCIIMIATWSKHAKPVACSGDWLGVRDKCF
YFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTFNGWFEI
IGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001130711
ORF Size 522 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001130711.2
RefSeq ORF 525 bp
Locus ID 387836
UniProt ID Q6UVW9
Cytogenetics 12p13.31
MW 19.8 kDa
Summary CLEC2A belongs to the CLEC2 family of activation-induced, natural killer gene complex-encoded C-type lectin-like receptors (Spreu et al., 2007 [PubMed 18046548]).[supplied by OMIM, May 2008]
Write Your Own Review
You're reviewing:CLEC2A (NM_001130711) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC225182L3 Lenti ORF clone of Human C-type lectin domain family 2, member A (CLEC2A), Myc-DDK-tagged 10 ug
$600.00
RC225182L4 Lenti ORF clone of Human C-type lectin domain family 2, member A (CLEC2A), mGFP tagged 10 ug
$600.00
RG225182 CLEC2A (tGFP-tagged) - Human C-type lectin domain family 2, member A (CLEC2A) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC325556 CLEC2A (untagged)-Human C-type lectin domain family 2, member A (CLEC2A) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.