CLEC2A (NM_001130711) Human Mass Spec Standard

SKU
PH325182
CLEC2A MS Standard C13 and N15-labeled recombinant protein (NP_001124183)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225182]
Predicted MW 19.8 kDa
Protein Sequence
Protein Sequence
>RC225182 representing NM_001130711
Red=Cloning site Green=Tags(s)

MINPELRDGRADGFIHRIVPKLIQNWKIGLMCFLSIIITTVCIIMIATWSKHAKPVACSGDWLGVRDKCF
YFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTFNGWFEI
IGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001124183
RefSeq ORF 522
Synonyms INPE5792; KACL; PILAR; UNQ5792
Locus ID 387836
UniProt ID Q6UVW9
Cytogenetics 12p13.31
Summary CLEC2A belongs to the CLEC2 family of activation-induced, natural killer gene complex-encoded C-type lectin-like receptors (Spreu et al., 2007 [PubMed 18046548]).[supplied by OMIM, May 2008]
Write Your Own Review
You're reviewing:CLEC2A (NM_001130711) Human Mass Spec Standard
Your Rating
SKU Description Size Price
TP325182 Purified recombinant protein of Homo sapiens C-type lectin domain family 2, member A (CLEC2A), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.