BLOC1S1 (NM_001487) Human Recombinant Protein

SKU
TP324412
Recombinant protein of human biogenesis of lysosomal organelles complex-1, subunit 1 (BLOC1S1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224412 protein sequence
Red=Cloning site Green=Tags(s)

MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQF
AKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001478
Locus ID 2647
UniProt ID P78537
Cytogenetics 12q13.2
RefSeq Size 590
RefSeq ORF 375
Synonyms BLOS1; BORCS1; GCN5L1; MICoA; RT14
Summary BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:BLOC1S1 (NM_001487) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH324412 BLOC1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001478) 10 ug
$3,255.00
LC419897 BLOC1S1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419897 Transient overexpression lysate of biogenesis of lysosomal organelles complex-1, subunit 1 (BLOC1S1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.