BLOC1S1 (NM_001487) Human Mass Spec Standard

SKU PH324412

BLOC1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001478)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC224412]
• Predicted MW: 14.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC224412 protein sequence; Red=Cloning site Green=Tags(s); ; MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQF; AKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001478
• RefSeq Size: 590
• RefSeq ORF: 375
• Synonyms: BLOS1; BORCS1; GCN5L1; MICoA; RT14
• Locus ID: 2647
• UniProt ID: P78537
• Cytogenetics: 12q13.2
• Summary: BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).[supplied by OMIM, Mar 2008]