OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BLOC1S1 (NM_001487) Human Mass Spec Standard

Be the first to review this product
SKU
PH324412
BLOC1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001478)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335195 Rabbit Polyclonal Anti-BLOC1S1 Antibody
100 ul
$585.00
LY419897 Transient overexpression lysate of biogenesis of lysosomal organelles complex-1, subunit 1 (BLOC1S1) (as WB positive control) 100 ug
$436.00

Other products for "BLOC1S1 or NM_001487"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224412
Predicted MW 14.3 kDa
Protein Sequence
Protein Sequence
>RC224412 protein sequence
Red=Cloning site Green=Tags(s)

MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQF
AKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001478
RefSeq Size 590
RefSeq ORF 375
Synonyms BLOS1; BORCS1; GCN5L1; MICoA; RT14
Locus ID 2647
UniProt ID P78537
Cytogenetics 12q13.2
Summary BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 PubMed 15102850).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BLOC1S1" proteins (3)
SKU Description Size Price
LC419897 Lyophilized BLOC1S1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419897 Transient overexpression lysate of biogenesis of lysosomal organelles complex-1, subunit 1 (BLOC1S1) (as WB positive control) 100 ug
$436.00
TP324412 Recombinant protein of human biogenesis of lysosomal organelles complex-1, subunit 1 (BLOC1S1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products